peptide garden
Peptide Profile

Tirzepatide

Tirzepatide (LY3298176)

An FDA-approved dual GIP/GLP-1 receptor agonist for type 2 diabetes, weight management, and sleep apnea. Head-to-head superiority over semaglutide for weight loss.

Reviewed August 22, 2026·21 min read·34 citations·FDA-approvedPrescription required

Regulatory update: August 2026

Nothing changed at the FDA between late June and mid-August 2026 — no new approvals, indications, or label supplements for tirzepatide, and still no cardiovascular indication. Compounded tirzepatide remains outside FDA enforcement guidelines except for documented patient-specific needs.

Updated August 15, 2026

At a glance

Tirzepatide is the first dual GIP/GLP-1 receptor agonist -- a "twincretin" that activates two gut hormone pathways instead of one. It is FDA-approved for type 2 diabetes (Mounjaro), chronic weight management (Zepbound), and obstructive sleep apnea (Zepbound). Head-to-head data shows it produces significantly greater weight loss than semaglutide.

Animal studiesStrongExtensive preclinical

Comprehensive preclinical pharmacology program supporting dual GIP/GLP-1 agonism. Demonstrated synergistic metabolic effects in multiple animal models prior to human trials.

Human evidenceExceptionally strong10,000+ participants

Multiple completed Phase III RCTs across two major programs (SURPASS for T2D, SURMOUNT for obesity) with 10,000+ total participants. Three FDA-approved indications. Head-to-head superiority over semaglutide demonstrated.

Safety dataExcellent10,000+ participants

Extensive controlled safety data from Phase III programs plus post-marketing pharmacovigilance (FAERS). Known risk profile: GI events, thyroid C-cell tumor risk (black box warning), pancreatitis, dysesthesia signal at higher doses.

How are these scores calculated?

Tirzepatide has one of the strongest clinical evidence bases of any peptide therapeutic. What that means: the efficacy for weight loss, blood sugar control, and related conditions is well-established across thousands of patients in rigorous Phase III trials. Risks are also well-characterized.

New research, delivered clearly

When new studies publish or clinical trials report results, we'll break them down in plain language.

Quick facts

Molecular weight
4,813.45 Da
Amino acids
39 (with Aib modifications)
Half-life
~5 days (once-weekly dosing)
Developer
Eli Lilly and Company
FDA status
Approved (3 indications)
WADA status
Monitoring Program (not prohibited)

Amino acid sequence

YA\u0302EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ


What is tirzepatide?

Tirzepatide is a synthetic peptide -- a 39-amino-acid chain -- that simultaneously activates two receptors for gut hormones: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1).[9] This dual-receptor approach earned it the nickname "twincretin."

The compound was developed by Eli Lilly and Company, with core patents filed in 2016. It received its first FDA approval in May 2022 as Mounjaro for type 2 diabetes, followed by approval as Zepbound for chronic weight management in November 2023, and for obstructive sleep apnea in December 2024.[16][17]

Tirzepatide is built on the GIP amino acid backbone, but has been engineered to also activate the GLP-1 receptor. Several structural modifications make it long-acting: two non-coded amino acid residues (Aib at positions 2 and 13) protect it from enzymatic breakdown, and a C20 fatty diacid moiety attached to Lys20 enables it to bind to albumin in the bloodstream, extending its half-life to approximately 5 days and allowing once-weekly dosing.

Unlike many peptides covered on Peptide Garden, tirzepatide has gone through the full FDA approval process -- large-scale Phase III trials with thousands of participants, extensive safety monitoring, and post-marketing surveillance. The evidence base here is fundamentally different from that of research-stage peptides.


How it works

In plain terms, tirzepatide mimics two gut hormones that your body naturally releases after eating. These hormones -- GIP and GLP-1 -- help control blood sugar, reduce appetite, and regulate how your body stores energy. By activating both pathways at once, tirzepatide produces stronger effects on weight and blood sugar than drugs that target only one.[10]

Think of it as working on two channels simultaneously: one primarily affecting insulin response and fat metabolism (GIP), and another primarily affecting appetite and glucose regulation (GLP-1). The combination produces more than the sum of its parts.

Detailed mechanism (for advanced readers)

Tirzepatide is an imbalanced and biased dual GIP/GLP-1 receptor agonist:[9]

GIP receptor agonism (primary):

  • Full agonist at the GIP receptor with high affinity -- this is the dominant receptor interaction
  • GIP signaling in adipose tissue promotes lipid storage and improves insulin sensitivity
  • GIP receptor activation in the brain may contribute to appetite suppression
  • The GIP component likely explains the enhanced weight loss beyond what GLP-1 agonism alone achieves

GLP-1 receptor agonism (biased):

  • Functions as a biased agonist at GLP-1R, favoring cAMP generation over beta-arrestin recruitment
  • Weaker GLP-1 receptor internalization compared with native GLP-1 -- which may contribute to a different side-effect profile
  • Glucose-dependent insulin secretion from pancreatic beta cells
  • Glucagon suppression from alpha cells
  • Delayed gastric emptying
  • Central appetite regulation via hypothalamic and brainstem GLP-1 receptors

Synergistic effects:

  • Co-activation produces synergistic insulin response and glucagonostatic response beyond either pathway alone
  • Increases adiponectin levels (improves insulin sensitivity)
  • Greater reduction in hepatic fat content compared to selective GLP-1 agonists

Pharmacokinetics:

  • C20 fatty diacid modification enables albumin binding, extending half-life to ~5 days
  • Aib residues at positions 2 and 13 provide DPP-4 resistance
  • Enables once-weekly subcutaneous dosing

How it differs from semaglutide: Semaglutide activates only the GLP-1 receptor. Tirzepatide activates both GIP and GLP-1 receptors, with a bias toward GIP. This dual mechanism is thought to explain the superior weight loss and glycemic outcomes observed in head-to-head trials.[12]


What the research says

Tirzepatide has one of the strongest evidence bases in modern pharmacology, with over 10,000 participants across Phase III programs, three FDA-approved indications, and head-to-head superiority over the leading comparator. The clinical data is world-class.

Peptide Garden evidence assessment, June 2026

Research timeline

Tirzepatide has moved from first-in-human dosing to three FDA approvals in under a decade -- a remarkably fast trajectory reflecting the strength of the clinical data:

  1. 2016Milestone

    Core patent filed

    Eli Lilly files patent (US 9,474,780) for the first dual GIP/GLP-1 receptor agonist. Tirzepatide (LY3298176) enters preclinical and early clinical development.

  2. 2020Preclinical

    Mechanism of action characterized

    Willard et al. publish the key mechanistic paper in JCI Insight, establishing tirzepatide as an 'imbalanced and biased' dual agonist with dominant GIP activity.

  3. 2021Human study

    SURPASS program reports (T2D)

    SURPASS-1 and SURPASS-2 published. SURPASS-2 demonstrates superiority over semaglutide 1 mg for both HbA1c and weight in 1,879 patients with type 2 diabetes.

  4. 2022Regulatory

    FDA approves Mounjaro (T2D)

    Tirzepatide approved as Mounjaro for type 2 diabetes (May 2022). SURMOUNT-1 published: 22.5% weight loss at highest dose in obesity.

  5. 2023Regulatory

    FDA approves Zepbound (obesity)

    Tirzepatide approved as Zepbound for chronic weight management (November 2023). Becomes the most prescribed weight management medication.

  6. 2024Regulatory

    OSA approval + diabetes prevention data

    FDA approves Zepbound for obstructive sleep apnea (December 2024). Three-year SURMOUNT-1 extension shows 94% diabetes risk reduction in prediabetes.

  7. 2024Regulatory

    Compounding era ends

    FDA removes tirzepatide from drug shortage list (October 2024). Compounding enforcement begins for 503A pharmacies (February 2025) and 503B facilities (March 2025).

  8. 2025Human study

    SURMOUNT-5: superiority over semaglutide confirmed

    Head-to-head trial (n=751) published in NEJM: tirzepatide 20.2% vs. semaglutide 13.7% weight loss at 72 weeks. Court upholds FDA compounding decision.

  9. 2025Human study

    SURPASS-CVOT reports (cardiovascular outcomes)

    First dedicated CV outcomes trial (n=13,299, vs. dulaglutide) published in NEJM (December 2025). 3-point MACE 12.2% vs. 13.1%; HR 0.92 -- noninferiority to an established GLP-1 RA met, superiority not met.

  10. 2026Human study

    August 2026 -- large observational study fills the placebo-comparison gap

    A BMJ target trial emulation of 52,971 adults with type 2 diabetes and established cardiovascular disease compared tirzepatide against sitagliptin as a placebo proxy: 1-year MACE risk 2.9% vs. 4.4%, HR 0.68, number needed to treat 70. Observational, not randomized -- but it addresses the question SURPASS-CVOT's active-comparator design could not.

Human clinical trials

Tirzepatide has been studied in two major Phase III programs with a combined enrollment exceeding 10,000 participants:

SURPASS program (Type 2 Diabetes): Five core trials (SURPASS-1 through SURPASS-5) enrolling over 6,000 patients demonstrated superior glycemic control and weight loss across all comparators, including semaglutide 1 mg, insulin glargine, and insulin degludec.[4][3]

SURMOUNT program (Obesity/Weight Management): Five core trials enrolling over 5,000 patients, including the landmark SURMOUNT-1 trial and the head-to-head SURMOUNT-5 comparison against semaglutide.[1][2]

2022·Phase III, double-blind, randomized, placebo-controlled·n=2539High quality

SURMOUNT-1: Tirzepatide for obesity (without T2D)

Obesity or overweight without type 2 diabetes

Weight loss of 16.0% (5 mg), 21.4% (10 mg), and 22.5% (15 mg) vs. 3.1% placebo at 72 weeks. Among participants with prediabetes, 94% risk reduction in progression to type 2 diabetes over 176 weeks.

2025·Phase IIIb, open-label, randomized, active-controlled·n=751High quality

SURMOUNT-5: Head-to-head vs. semaglutide

Obesity without type 2 diabetes

Tirzepatide achieved 20.2% weight loss vs. 13.7% for semaglutide 2.4 mg at 72 weeks. First direct head-to-head comparison demonstrating tirzepatide's superiority for weight reduction.

2021·Phase III, open-label, randomized, active-controlled·n=1879High quality

SURPASS-2: Tirzepatide vs. semaglutide in T2D

Type 2 diabetes mellitus

Superior HbA1c reduction (up to 2.46% vs. 1.86%) and weight loss (up to 11.2 kg vs. 5.7 kg) compared with semaglutide 1 mg at 40 weeks.

2023·Phase III, double-blind, randomized withdrawal·n=670High quality

SURMOUNT-4: Weight maintenance after discontinuation

Weight maintenance in obesity

After 36 weeks of tirzepatide, participants randomized to placebo regained substantial weight. Most regained 25%+ of lost weight within one year. Demonstrates that ongoing treatment is necessary.

2024·Phase III, double-blind, randomized, placebo-controlled (2 trials)·n=469High quality

SURMOUNT-OSA: Obstructive sleep apnea

Moderate-to-severe OSA with obesity

AHI reduction of 25-29 events/hour with tirzepatide vs. 5 events/hour with placebo. Tirzepatide became the first drug approved specifically for OSA.

2026·Observational cohort (two national US claims databases), propensity-score overlap weighted·n=52971Moderate quality

BMJ target trial emulation: tirzepatide vs. a placebo-proxy comparator

Type 2 diabetes with established atherosclerotic cardiovascular disease

1-year MACE risk 2.9% with tirzepatide vs. 4.4% with sitagliptin; HR 0.68 (95% CI 0.58-0.80), number needed to treat 70. All-cause mortality HR 0.55. Observational, not randomized -- but it uses a cardiovascularly neutral comparator, which SURPASS-CVOT did not.

What makes this evidence different: Unlike many peptides on Peptide Garden, tirzepatide has been studied in large, multi-center, randomized controlled trials -- the gold standard of clinical evidence. The SURMOUNT-1 trial alone (n=2,539) enrolled more participants than the entire published human literature for most peptides combined.


What the evidence shows

People come to tirzepatide primarily for weight loss and blood sugar control. Here's what the published research tells us about the most common areas of interest:

Does tirzepatide produce significant weight loss?

Yes. Multiple Phase III RCTs consistently demonstrate 15-22% body weight loss at maximum dose. SURMOUNT-1 (n=2,539) showed 22.5% loss at 15 mg over 72 weeks. SURMOUNT-5 (n=751) demonstrated superiority over semaglutide 2.4 mg (20.2% vs. 13.7%). This is the strongest weight loss data for any approved medication.

Well-supported

Does tirzepatide reduce blood sugar in type 2 diabetes?

Yes. The SURPASS program (6,000+ patients across 5 core trials) consistently demonstrates HbA1c reductions of 1.24-2.58%. SURPASS-2 showed superiority over semaglutide 1 mg. 23-62% of patients across trials achieved normoglycemia (HbA1c <5.7%).

Well-supported

Can tirzepatide prevent type 2 diabetes?

In the SURMOUNT-1 prediabetes subgroup, tirzepatide reduced progression to type 2 diabetes by 94% vs. placebo over 176 weeks. Over 95% of prediabetic participants converted to normoglycemia. This is a remarkably strong prevention signal.

Well-supported

Is tirzepatide better than semaglutide for weight loss?

Head-to-head data from SURMOUNT-5 shows tirzepatide achieved 20.2% weight loss vs. 13.7% for semaglutide at maximum tolerated doses over 72 weeks. On cardiovascular outcomes the comparison is more nuanced: semaglutide has a placebo-controlled CV-event reduction (SELECT), while tirzepatide's dedicated trial, SURPASS-CVOT, showed noninferiority to dulaglutide (an established GLP-1 RA) but did not meet superiority.

Well-supported

Does tirzepatide improve sleep apnea?

Yes. FDA approved tirzepatide for moderate-to-severe OSA in December 2024 based on the SURMOUNT-OSA trials. AHI was reduced by 25-29 events/hour with tirzepatide vs. 5 with placebo. The first drug approved specifically for OSA.

Well-supported

What happens when you stop tirzepatide?

SURMOUNT-4 demonstrated substantial weight regain after discontinuation. Most participants who stopped after 36 weeks regained 25%+ of lost weight within one year. Cardiometabolic improvements also reversed. This is consistent across all GLP-1 class therapies -- obesity is a chronic condition requiring ongoing treatment.

Well-supported

Does tirzepatide protect against cardiovascular events?

Probably, though the randomized evidence is still indirect. SURPASS-CVOT (n=13,299; vs. dulaglutide; NEJM, December 2025) met noninferiority for 3-point MACE (12.2% vs. 13.1%; HR 0.92, 95.3% CI 0.83-1.01) but not superiority (P=0.09) -- and because dulaglutide itself reduces MACE, that design could not show how tirzepatide compares with no treatment. A 2026 BMJ target trial emulation addressed that gap observationally: among 52,971 adults with type 2 diabetes and established atherosclerotic disease, 1-year MACE risk was 2.9% with tirzepatide vs. 4.4% with sitagliptin (a cardiovascularly neutral placebo proxy), HR 0.68 (95% CI 0.58-0.80), number needed to treat 70; all-cause mortality HR 0.55. That is claims data, not a trial, and tirzepatide still has no FDA cardiovascular indication. Separately, SUMMIT (n=731) showed a 38% reduction in CV death or worsening heart failure in HFpEF with obesity, but Lilly withdrew the U.S. heart-failure application in 2025 after the FDA required a confirmatory trial.

Some supporting evidence

Does tirzepatide cause hair loss?

Unclear. A 2026 BMJ target trial emulation found adults with type 2 diabetes starting a GLP-1 receptor agonist had more diagnosed alopecia than those starting an SGLT-2 inhibitor (HR 1.37, 95% CI 1.08-1.73) or DPP-4 inhibitor (HR 1.68, 1.28-2.20), strongest for the non-scarring subtype. It is observational, from one health system, uses diagnostic codes as the outcome, and attenuates after negative-control calibration. Rapid weight loss from any cause can trigger temporary shedding (telogen effluvium), which this design cannot separate out.

More research needed

Is tirzepatide safe to use in pregnancy?

Not established, and not recommended -- tirzepatide is contraindicated in pregnancy. Class-level exposure evidence grew through mid-2026 and is consistently reassuring: a meta-analysis of 8 studies and 186,598 pregnancies found no significant difference in gestational diabetes, preterm birth, preeclampsia or hypertensive disorders, and an international consensus guideline reported that no included study found an increase in congenital anomalies. None declares the drug safe, most of the exposure data is for GLP-1 agonists rather than tirzepatide specifically, and the syntheses overlap in their source cohorts.

More research needed

Safety & side effects

What clinical trials show

Tirzepatide's safety profile is well-characterized from Phase III programs with over 10,000 participants and extensive post-marketing surveillance.[13]

Gastrointestinal events (the most common side effects): These are dose-dependent and typically most pronounced during dose escalation:

  • Nausea: ~20% (vs. ~10% comparators)
  • Diarrhea: ~16% (vs. ~9% comparators)
  • Vomiting: ~9% (vs. ~5% comparators)
  • Constipation: ~7%
  • Decreased appetite (common, dose-dependent)
  • Dyspepsia/abdominal pain (common)

GI side effects occurred in 39% (5 mg), 46% (10 mg), and 49% (15 mg) of patients. Most were mild-to-moderate, transient, and occurred during dose escalation periods. The slow dose-titration schedule (4 weeks per increment) is specifically designed to minimize these effects.

Beyond the common, transient events above, the FDA label also lists less common postmarketing GI adverse reactions: ileus, intestinal obstruction, and severe constipation including fecal impaction. These are uncommon but worth knowing about, particularly if severe abdominal symptoms develop.[21]

Serious safety concerns

Black box warning -- thyroid C-cell tumors: Tirzepatide caused a statistically significant increase in thyroid C-cell adenomas and carcinomas in rodent studies. Human relevance is undetermined, but the drug is contraindicated in patients with a personal or family history of medullary thyroid carcinoma (MTC) or Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).

  • Pancreatitis: Acute pancreatitis has been reported. Contraindicated in patients with a history of pancreatitis.
  • Cholecystitis/gallstones: Incidence up to 0.6% in trials. Risk appears related to rapid weight loss.
  • Acute kidney injury: Reported, likely related to dehydration from GI events. Use caution in patients with renal impairment.
  • Pulmonary aspiration during anesthesia: Because tirzepatide delays gastric emptying, the FDA label carries a Warnings & Precautions note on pulmonary aspiration during general anesthesia or deep sedation -- there have been rare reports of retained gastric contents despite recommended preoperative fasting. Tell your care team you are taking tirzepatide before any surgery or procedure. (Note: the specific perioperative guidance to "hold the drug" before surgery comes from anesthesiology societies, not the FDA label itself.)[21]
  • Lean mass loss: Approximately 25% of total weight lost is lean mass (the remaining 75% is fat mass). This ratio is consistent across dose groups and comparable to other weight-loss interventions.[14] A 2026 European consensus statement (EASO, EFAD and ECPO) sets out practical nutrition, physical-function and psychological guidance for adults on incretin therapy — currently the best guideline-grade anchor for managing muscle and micronutrient concerns.[31]
  • Weight regain on discontinuation: SURMOUNT-4 demonstrated that most patients who stop tirzepatide regain a substantial portion of lost weight within one year.[6]

Emerging safety signals

Dysesthesia at higher doses

A dysesthesia safety signal (tingling, burning, or altered skin sensation) has drawn attention across the incretin class, but the most striking figure belongs to retatrutide -- the triple GIP/GLP-1/glucagon agonist -- where dysesthesia affected approximately 21% of participants at the 12 mg dose in its Phase 2 obesity program. This is thought to be linked to glucagon receptor activity rather than GIP/GLP-1 agonism specifically. Tirzepatide, which lacks glucagon receptor activity and is not dosed at 12 mg (its escalation tops out at 15 mg), does not carry a comparable dysesthesia signal -- its most common adverse events remain gastrointestinal. The clinical significance and long-term implications of the retatrutide finding are still being evaluated.

Heart rate increase

Tirzepatide is associated with a resting heart rate increase of 5-10 beats per minute, typically peaking at week 24. This is a class effect shared with GLP-1 receptor agonists. Its cardiovascular significance was addressed by the dedicated SURPASS-CVOT outcomes trial (n=13,299, vs. dulaglutide), which reported in late 2025: tirzepatide met noninferiority to dulaglutide for major adverse cardiovascular events but did not demonstrate superiority.[18]

NAION ('eye stroke')

As with other GLP-1-based drugs, a possible association with NAION ("eye stroke") has been discussed. A 2026 NANOS/AAO consensus put any increase at roughly two-fold at most with low absolute risk and advised shared decision-making rather than stopping treatment.[22]

In July 2026, Annals of Internal Medicine published two independent observational studies on the same day. Both looked at the GLP-1 class rather than tirzepatide alone, and both landed in the same place: the relative risk is elevated, the absolute risk is very small, and some of the signal is probably confounding. A US target trial emulation in commercial claims found an 18-month risk of ischemic optic neuropathy of 8.5 versus 5.5 per 10,000 compared with SGLT2 inhibitors — a number needed to harm of about 3,300.[25] A Swedish nationwide cohort found one-year risk of 0.04% versus 0.02% (RR 1.93, 95% CI 1.00–3.73), and when the analysis was restricted to people already on metformin, the association shrank substantially — a sign that part of it reflects who takes these drugs rather than the drugs themselves.[26]

The strongest drug-specific data remain for semaglutide (see that profile). Sudden, painless vision loss in one eye warrants prompt ophthalmology evaluation regardless of which drug you take.

Hair loss (alopecia)

Hair thinning has been an anecdotal complaint on GLP-1-based drugs for years. In July 2026 it got its first serious study: a BMJ target trial emulation in adults with type 2 diabetes found higher rates of diagnosed alopecia after starting a GLP-1 receptor agonist than after starting an SGLT-2 inhibitor (HR 1.37, 95% CI 1.08–1.73) or a DPP-4 inhibitor (HR 1.68, 1.28–2.20), strongest for non-scarring alopecia.[27]

Read that in proportion. It is a single health system, type 2 diabetes only, the outcome is a diagnostic code rather than a dermatology assessment, and the authors report the effect attenuates after negative-control calibration. Substantial weight loss from any cause can trigger telogen effluvium — a temporary shedding phase that usually resolves — and this design cannot separate that from a drug effect. If you notice shedding, it is worth raising with your prescriber and worth checking iron, thyroid and protein intake rather than assuming the drug is responsible.

Treatment discontinuation

Approximately 10% of participants at the 15 mg dose discontinued treatment due to adverse events in clinical trials (vs. 4% for placebo). Most discontinuations were due to GI side effects during dose escalation.

Contraindications and drug interactions

Contraindications:

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN 2)
  • History of pancreatitis
  • Hypersensitivity to tirzepatide or excipients
  • Pregnancy (animal reproductive toxicity observed)

On pregnancy specifically. Tirzepatide is contraindicated in pregnancy, and that has not changed. What has improved is the answer for people who conceive unexpectedly while taking an incretin drug. Through mid-2026, several syntheses were published and none found a safety signal: a meta-analysis of 8 studies and 186,598 pregnancies found no significant difference in gestational diabetes, preterm birth, preeclampsia or hypertensive disorders of pregnancy,[28] and an international multidisciplinary consensus guideline published the same summer reported that no included study found an increase in congenital anomalies, alongside practical guidance on contraception, preconception planning and lactation.[29] Two honest caveats: none of these papers declares any incretin safe in pregnancy, and most of the underlying exposure data is for GLP-1 receptor agonists rather than tirzepatide specifically. Tirzepatide also may reduce the effectiveness of oral contraceptives during initiation and dose escalation, which matters here. If you are pregnant, planning a pregnancy, or find you have conceived on tirzepatide, that is a conversation to have with your clinician — not a reason to panic.

Drug interactions:

  • Insulin / sulfonylureas: Increased hypoglycemia risk; dose reduction recommended when combining.
  • Oral medications: Delayed gastric emptying may affect absorption of co-administered oral drugs (426 documented potential interactions).
  • Oral contraceptives: Potential absorption impact during initiation and dose escalation; counsel patients.

FDA-approved dosing

Tirzepatide is available as a pre-filled pen injector (KwikPen) for once-weekly subcutaneous injection. The following dosing schedule is from the FDA-approved prescribing information for both Mounjaro and Zepbound:

Period Dose Notes
Weeks 1-4 2.5 mg/week Starter dose (not therapeutic for weight loss)
Weeks 5-8 5.0 mg/week First maintenance dose
Weeks 9-12 7.5 mg/week Escalation if additional response needed
Weeks 13-16 10.0 mg/week Maintenance dose
Weeks 17-20 12.5 mg/week Escalation if needed
Weeks 21+ 15.0 mg/week Maximum maintenance dose
  • Maintenance doses: 5 mg, 10 mg, or 15 mg weekly
  • Maximum dose: 15 mg subcutaneously once weekly
  • Administration: Subcutaneous injection in abdomen, thigh, or upper arm
  • Dose increases: In 2.5 mg increments after a minimum of 4 weeks at each dose level. Slow escalation reduces GI side effects.
  • No oral formulation is currently available (unlike semaglutide)

Important: Tirzepatide is a prescription medication. The dosing above is from FDA-approved labeling. Dosing should be supervised by a healthcare provider who can adjust based on individual tolerability and clinical response.


As of August 2026:

FDA status

Tirzepatide is FDA-approved for three indications:

  • Mounjaro (May 2022): Type 2 diabetes mellitus
  • Zepbound (November 2023): Chronic weight management in adults with obesity (BMI 30+) or overweight (BMI 27+) with at least one weight-related comorbidity
  • Zepbound (December 2024): Moderate-to-severe obstructive sleep apnea in adults with obesity

It is available only with a prescription. A monthly pre-filled pen (KwikPen) option has been approved by the FDA.[16][17]

Nothing changed between late June and mid-August 2026. No new approvals, no new indications, and no approved label supplements for tirzepatide in that window. In particular, the strong observational cardiovascular result published in August 2026 is not a regulatory event — tirzepatide still carries no FDA cardiovascular indication.

The compounding story

This is one of the most significant regulatory developments of 2024-2025 and directly affects patient access:

  • When Eli Lilly could not meet demand, tirzepatide was placed on the FDA drug shortage list, which temporarily permitted compounding pharmacies to produce it.
  • In October 2024, the FDA removed tirzepatide from the shortage list, beginning the process of ending compounding.
  • February 18, 2025: Compounding discretion ended for Section 503A pharmacies (state-licensed).
  • March 19, 2025: Compounding discretion ended for Section 503B outsourcing facilities.
  • May 2025: US District Court upheld FDA's shortage resolution decision.

Current status: As of August 2026, tirzepatide cannot be legally compounded except for documented patient-specific medical needs (e.g., documented allergy to an inactive ingredient in the approved product). This is a significant difference from semaglutide, where some compounding flexibility has remained longer. Anyone offering "compounded tirzepatide" today is likely operating outside FDA enforcement guidelines.[15]

That is the rule. The market is another matter. A July 2026 secret-shopper study in JAMA Health Forum contacted weight-loss clinics and medical spas in West Virginia and Oklahoma and found 75 businesses still selling compounded GLP-1 medications more than a year after the shortages ended — including oral formulations and products mixed with B vitamins, neither of which matches any FDA-approved product. Among the supplying compounding facilities the researchers could verify, 4 of 21 (19.0%) were not licensed to perform sterile compounding at all. Two caveats: the data were collected in late 2025, and two states are not a national picture. But if you are being offered compounded tirzepatide, the licensure question is a fair and specific one to ask.[30]

Pricing

  • Mounjaro (list price): ~$1,080/month (any dose strength)
  • Zepbound (list price): ~$1,086/month
  • LillyDirect (Zepbound vial, self-pay): $499/month (with timely refill)
  • With Eli Lilly Savings Card: Copay as low as $25/month for commercially insured patients
  • Medicare: A temporary CMS demonstration, the GLP-1 Bridge, began July 1, 2026 and offers eligible Part D and MA-PD enrollees roughly $50 per 30-day supply of Zepbound KwikPen for weight management. It sits outside the standard Part D benefit, so copays do not count toward the deductible or the out-of-pocket cap. Published accounts of the end date and covered-drug list disagree — check CMS directly rather than a summary

WADA / USADA status

Tirzepatide is not prohibited by WADA. It is currently on the WADA Monitoring Program (2026) alongside semaglutide, meaning its use by athletes is being tracked but does not constitute a violation. It could potentially move to the prohibited list in future updates. A decision on whether to prohibit GLP-1-based drugs is expected by the end of 2026 or in 2027, potentially ahead of the LA 2028 Olympics.


How tirzepatide compares to semaglutide

Semaglutide is the natural comparator -- both are injectable GLP-1 pathway drugs used for weight management and diabetes. Here's how they stack up based on head-to-head and cross-trial data:

Tirzepatide

FDA-approved · Dual GIP/GLP-1 agonist

Weight loss (max dose)20-22%
HbA1c reduction2.0-2.6%
CV outcomes dataNoninferior vs. dulaglutide

Mechanism

GIP + GLP-1

Dosing

Weekly SC

Approved for

3 indications

Compounding

Not permitted

Semaglutide

FDA-approved · GLP-1 agonist

Weight loss (max dose)13-17%
HbA1c reduction1.5-1.9%
CV outcomes dataSELECT (proven)

Mechanism

GLP-1 only

Dosing

Weekly SC / oral

Approved for

3+ indications

Compounding

Limited access

The key tradeoffs:

  • Weight loss: Tirzepatide wins. SURMOUNT-5 head-to-head: 20.2% vs. 13.7% at 72 weeks.[2]
  • Glycemic control: Tirzepatide wins. SURPASS-2: HbA1c reduction of 2.46% vs. 1.86%.[3]
  • Cardiovascular protection: Semaglutide retains the edge in randomized evidence. The SELECT trial (n=17,604) demonstrated a 20% reduction in MACE events versus placebo. Tirzepatide's dedicated SURPASS-CVOT trial (n=13,299) met noninferiority to dulaglutide (an established GLP-1 RA) for 3-point MACE but did not show superiority -- a different, weaker bar than SELECT's placebo-controlled event reduction.[18] That comparison changed in August 2026, though not in the trial column: a BMJ target trial emulation of 52,971 adults with type 2 diabetes and established atherosclerotic disease compared tirzepatide against sitagliptin -- a cardiovascularly neutral placebo proxy -- and found 1-year MACE risk of 2.9% vs. 4.4% (HR 0.68, 95% CI 0.58-0.80, number needed to treat 70), with all-cause mortality also lower (HR 0.55). It is observational claims data, so it cannot carry the weight of a randomized placebo-controlled trial, and it does not create an FDA indication. But it does answer the question SURPASS-CVOT's design left open, and it points the same direction.[24] A separate trial, SUMMIT, found tirzepatide cut cardiovascular death or worsening heart failure by 38% in people with HFpEF and obesity,[19] but Lilly withdrew its U.S. heart-failure application in 2025 after the FDA required a confirmatory trial, so tirzepatide carries no heart-failure indication.[20] A June 2026 JACC post hoc analysis of SURMOUNT-1 found tirzepatide broadly improved cardiovascular risk biomarkers, including inflammation (hsCRP).[23]
  • Oral option: Semaglutide has an oral formulation (Rybelsus/oral Wegovy). Tirzepatide is injection-only.
  • Compounding access: Semaglutide has maintained some compounding flexibility. Tirzepatide compounding is no longer permitted.
  • Cost: Comparable at list price (~$1,000-1,100/month).

Neither drug is universally superior. The choice between them depends on clinical priorities: maximum weight loss and glycemic control favor tirzepatide; randomized, placebo-controlled cardiovascular evidence and oral dosing favor semaglutide.



References

  1. [1]
    Jastreboff AM, Aronne LJ, Ahmad NN, et al.. “Tirzepatide Once Weekly for the Treatment of Obesity.” N Engl J Med. 2022. 387(3):205-216 DOI PubMedRCT

    Landmark Phase III RCT. n=2,539. Demonstrated up to 22.5% weight loss at 15 mg dose. Basis for Zepbound approval.

  2. [2]
    Aronne LJ, Horn DB, le Roux CW, et al.. “Tirzepatide as Compared with Semaglutide for the Treatment of Obesity.” N Engl J Med. 2025. DOI PubMedRCT

    First head-to-head comparison. n=751. Tirzepatide 20.2% vs. semaglutide 13.7% weight loss at 72 weeks. Open-label design.

  3. [3]
    Frías JP, Davies MJ, Rosenstock J, et al.. “Tirzepatide versus Semaglutide Once Weekly in Patients with Type 2 Diabetes.” N Engl J Med. 2021. 385(6):503-515 DOI PubMedRCT

    Head-to-head vs. semaglutide 1 mg in T2D. n=1,879. Superior HbA1c and weight outcomes for tirzepatide.

  4. [4]
    Rosenstock J, Wysham C, Frias JP, et al.. “Efficacy and safety of a novel dual GIP and GLP-1 receptor agonist tirzepatide in patients with type 2 diabetes (SURPASS-1).” Lancet. 2021. 398(10295):143-155 DOI PubMedRCT

    First Phase III trial for tirzepatide. n=478. Monotherapy vs. placebo in treatment-naive T2D.

  5. [5]
    Jastreboff AM, Kaplan LM, Frias JP, et al.. “Tirzepatide for Obesity Treatment and Diabetes Prevention.” N Engl J Med. 2024. DOI PubMedRCT

    Three-year extension of SURMOUNT-1 in participants with prediabetes. 94% risk reduction in progression to T2D. n=1,032 prediabetes subgroup.

  6. [6]
    Aronne LJ, Sattar N, Horn DB, et al.. “Continued Treatment With Tirzepatide for Maintenance of Weight Reduction in Adults With Obesity: The SURMOUNT-4 Randomized Clinical Trial.” JAMA. 2024. 331(1):38-48 DOI PubMedRCT

    Withdrawal design. n=670. Demonstrates substantial weight regain upon discontinuation.

  7. [7]
    Garvey WT, Frias JP, Jastreboff AM, et al.. “Tirzepatide once weekly for the treatment of obesity in people with type 2 diabetes (SURMOUNT-2).” Lancet. 2023. 402(10402):613-626 DOI PubMedRCT

    Phase III in obesity with T2D. n=938. Weight loss of 12.8-14.7% vs. 3.2% placebo.

  8. [8]
    Malhotra A, Grunstein RR, Fietze I, et al.. “Tirzepatide for the Treatment of Obstructive Sleep Apnea and Obesity.” N Engl J Med. 2024. 391(13):1193-1205 DOI PubMedRCT

    Two Phase III trials. Combined n=469. AHI reduction of 25-29 events/hour. Basis for OSA indication approval.

  9. [9]
    Willard FS, Douros JD, Gabe MBN, et al.. “Tirzepatide is an imbalanced and biased dual GIP and GLP-1 receptor agonist.” JCI Insight. 2020. 5(17):e140532 DOI PubMedAnimal study

    Key mechanistic paper. Establishes tirzepatide as an imbalanced agonist favoring GIP over GLP-1 receptor activation.

  10. [10]
    Nauck MA, D'Alessio DA. “Tirzepatide, a dual GIP/GLP-1 receptor co-agonist for the treatment of type 2 diabetes with unmatched effectiveness regarding glycaemic control and body weight reduction.” Cardiovasc Diabetol. 2022. 21(1):169 DOI PubMedReview

    Comprehensive review of the SURPASS program with cardiovascular context.

  11. [11]
    Min T, Bain SC. “The Role of Tirzepatide, Dual GIP and GLP-1 Receptor Agonist, in the Management of Type 2 Diabetes: The SURPASS Clinical Trials.” Diabetes Ther. 2021. 12(1):143-157 DOI PubMedReview
  12. [12]
    Galindo RJ, Cheng AYY, Longuet C, Ai M, Coskun T, et al.. “Insights into the Mechanism of Action of Tirzepatide: A Narrative Review.” Diabetes Ther. 2026. 17(1):19-40 DOI PubMedReview

    Up-to-date narrative review of tirzepatide's pharmacology and dual receptor mechanism.

  13. [13]
    Almansour HA, Thaibah HA, Alfarhan M, Al-Qahtani SA, Khardali AA, Alshammari TM. “Real-World Safety Concerns of Tirzepatide: A Retrospective Analysis of FAERS Data (2022-2025).” Healthcare (Basel). 2025. 13(18):2259 DOI PubMedReview

    Analysis of 638,153 adverse events in FAERS. 8,096 tirzepatide-related events identified. Key signals: GI events, dosing errors, injection site reactions.

  14. [14]
    Look M, Dunn JP, Kushner RF, Cao D, Harris C, et al.. “Body composition changes during weight reduction with tirzepatide in the SURMOUNT-1 study of adults with obesity or overweight.” Diabetes Obes Metab. 2025. 27(5):2720-2729 DOI PubMedRCT

    SURMOUNT-1 body composition analysis. Of weight lost, ~75% was fat mass and ~25% lean mass, consistent across dose groups.

  15. [15]
    U.S. Food and Drug Administration. “FDA clarifies policies for compounders as national GLP-1 supply begins to stabilize.” 2024. Link
  16. [16]
    U.S. Food and Drug Administration. “FDA approves novel, dual-targeted treatment for type 2 diabetes (Mounjaro NDA 215866).” 2022. Link
  17. [17]
    U.S. Food and Drug Administration. “FDA approves new medication for chronic weight management (Zepbound NDA 217806).” 2023. Link
  18. [18]
    Nicholls SJ, et al.. “Cardiovascular Outcomes with Tirzepatide versus Dulaglutide in Type 2 Diabetes.” N Engl J Med. 2025. 393(24):2409-2420 DOI PubMedRCT

    SURPASS-CVOT. Dedicated CV outcomes trial. n=13,299 (analysis pop 13,165), tirzepatide vs. dulaglutide, ~4-year median follow-up. 3-point MACE 12.2% vs. 13.1%; HR 0.92 (95.3% CI 0.83-1.01); noninferiority met (P=0.003), superiority not met (P=0.09). Active-comparator design vs. an established GLP-1 RA.

  19. [19]
    Packer M, et al.. “Tirzepatide for Heart Failure with Preserved Ejection Fraction and Obesity (SUMMIT).” N Engl J Med. 2025. DOIRCT

    SUMMIT. n=731. Tirzepatide cut CV death/worsening heart failure by 38% (HR 0.62, 95% CI 0.41-0.95) in HFpEF with obesity.

  20. [20]
    ConscienHealth. “Lilly Withdraws Tirzepatide Application to FDA for Heart Failure.” 2025. LinkReview

    Lilly withdrew its U.S. HFpEF application after the FDA required a confirmatory trial; tirzepatide has no heart-failure indication.

  21. [21]
    U.S. Food and Drug Administration (DailyMed). “Mounjaro (tirzepatide) Prescribing Information.” 2026. LinkSafety study
  22. [22]
    North American Neuro-Ophthalmology Society & American Academy of Ophthalmology. “GLP-1 Receptor Agonists and the Risk of NAION: A Consensus Statement.” 2026. LinkReview
  23. [23]
    Sattar N, Ridker PM, et al.. “Comprehensive Long-Term Changes in Cardiovascular Risk Biomarkers With Tirzepatide: A SURMOUNT-1 Post Hoc Analysis.” J Am Coll Cardiol. 2026. DOI PubMedRCT
  24. [24]
    Krüger N, Schneeweiss S, Wang SV. “Tirzepatide and the risk of atherosclerotic cardiovascular events: population based cohort study.” BMJ. 2026. 394:e100011 DOI PubMedObservational study

    August 2026 target trial emulation across two national US claims databases (May 2022–May 2025). 52,971 adults aged 40+ with type 2 diabetes and established atherosclerotic disease initiating tirzepatide (n=35,353) or sitagliptin (n=17,618) as a cardiovascularly neutral placebo proxy, with propensity-score overlap weighting and 1-year follow-up. Weighted MACE risk 2.9% (95% CI 2.5–3.4) vs. 4.4% (3.8–4.9); HR 0.68 (0.58–0.80), NNT 70. MI HR 0.67 (0.52–0.87); ischaemic stroke HR 0.91 (0.64–1.28); all-cause mortality HR 0.55 (0.42–0.72). Prespecified negative control outcomes showed no association. Observational: it addresses the comparator gap SURPASS-CVOT left open, but it cannot replace a placebo-controlled trial.

  25. [25]
    Reynolds KR, O'Malley KM, Roy JA, Dave CV. “Glucagon-like peptide-1 receptor agonists and risk for ischemic optic neuropathy: a target trial emulation.” Ann Intern Med. 2026. DOI PubMedObservational study

    July 2026 target trial emulation in US commercial claims. 18-month ischemic optic neuropathy risk 8.5 vs. 5.5 per 10,000 versus SGLT2 inhibitors (risk difference 3.0, 95% CI 0.4–5.7) and 7.8 vs. 4.2 per 10,000 versus DPP4 inhibitors (3.6, 1.1–6.1) — numbers needed to harm of 3,333 and 2,778. Class-level; NAION-specific diagnostic codes were not available.

  26. [26]
    Ueda P, Svanström H, Söderling J, et al.. “Glucagon-like peptide-1 receptor agonists and risk for anterior ischemic optic neuropathy: a nationwide cohort study.” Ann Intern Med. 2026. DOI PubMedObservational study

    July 2026 Swedish nationwide cohort, 2013–2024. 62 of 107,518 GLP-1 receptor agonist initiators vs. 64 of 185,898 SGLT-2 inhibitor initiators developed anterior ischemic optic neuropathy; one-year risk 0.04% vs. 0.02% (RR 1.93, 95% CI 1.00–3.73). Restricting to people already on metformin attenuated the association substantially, which the authors read as evidence of residual confounding.

  27. [27]
    Tang H, Zhang B, Lu Y, et al.. “Risk of hair loss associated with glucagon-like peptide-1 receptor agonists in adults with type 2 diabetes: target trial emulation.” BMJ. 2026. 394:e100077 DOI PubMedObservational study

    Alopecia HR 1.37 (95% CI 1.08–1.73) vs. SGLT-2 inhibitors and 1.68 (1.28–2.20) vs. DPP-4 inhibitors, in one US health system's electronic health records. Class-level, diagnostic-code outcome, attenuates after negative-control calibration — an association, not established causation.

  28. [28]
    Hattler E, Schluter H, Greene C, et al.. “Glucagon-like peptide-1 receptor agonists and risk of adverse maternal pregnancy outcomes: a systematic review and meta-analysis.” Obstet Gynecol. 2026. DOI PubMedSystematic review

    8 studies, 186,598 pregnancies (47,159 exposed). No significant differences in gestational diabetes, preterm birth, preeclampsia or hypertensive disorders of pregnancy. Built on retrospective cohorts that overlap with other syntheses.

  29. [29]
    Maslin K, Shawe J, Blowers S, et al.. “Incretin-based medications in women and reproduction: a systematic scoping review and consensus guidelines for clinical practice.” Obes Rev. 2026.:e70203 DOI PubMedReview

    International multidisciplinary consensus guidance synthesising 34 articles; reports that no included study found an increase in congenital anomalies, and covers contraception, preconception planning, nutrition, pregnancy monitoring and lactation.

  30. [30]
    DiStefano MJ, Tilley A, Paratane D, et al.. “Postshortage compounded GLP-1 RA market in 2 states with potentially high demand.” JAMA Health Forum. 2026. 7(7):e262207 DOI PubMedObservational study

    Secret-shopper study of 75 weight-loss clinics and medical spas in West Virginia and Oklahoma still selling compounded GLP-1 products after the shortages ended. 4 of 21 verifiable supplying facilities (19.0%) were not licensed for sterile compounding. Data collected August–October 2025; two states only.

  31. [31]
    Dobbie LJ, Tolvanen L, Alves D, et al.. “Nutritional, functional, and psychological considerations for incretin-based therapies in adults — an EASO, EFAD, and ECPO consensus statement.” Lancet Diabetes Endocrinol. 2026. 14(9):754–777 DOI PubMedReview

    Consensus statement from the European Association for the Study of Obesity, the European Federation of the Associations of Dietitians and the European Coalition for People living with Obesity on nutrition, physical function and psychological care during incretin-based therapy.

  32. [32]
    Viquez Burboa GU, Flores Guillén MÁR, Duardo González VS. “GLP-1 Receptor Agonists and Alopecia: A Systematic Review and Meta-Analysis of Incidence, Risk, Subtypes, and Mechanisms.” Skin Appendage Disord. 2026. DOI PubMedSystematic review

    17 studies, 1,091,743 patient-exposures, searched to March 31, 2026. PROSPERO-registered, PRISMA 2020. Pools cohort studies with pharmacovigilance disproportionality analyses; the latter measure reporting rather than incidence. No conflicts declared.

  33. [33]
    Chen QX, Zhou XY, Wu Q, et al.. “Effect of tirzepatide and semaglutide on blood pressure: A systematic review and meta-analysis.” Endocrine. 2026. 91(1):275 DOI PubMedSystematic review

    32 randomized controlled trials, 47,332 participants, six databases searched to September 26, 2025. Outcomes are treatment-emergent adverse event counts, not measured blood pressure, so the estimates describe reported events rather than haemodynamics. No competing interests declared.

  34. [34]
    Banerjee M, Roy A, Sharma VM, Das A. “Major Adverse Liver Outcomes With Tirzepatide and Injectable Semaglutide in Adults With Overweight or Obesity and Type 2 Diabetes.” Obesity (Silver Spring). 2026. DOI PubMedObservational study

    Retrospective target trial emulation in the TriNetX global federated network, propensity-score matched, median follow-up about 17 months. A null result on a hard outcome, with the usual EHR limitations: coded outcomes, unmeasured confounding, and a follow-up window short relative to cirrhosis timescales.


Medical disclaimer

Peptide Garden is an educational resource, not a medical provider. The information on this page is compiled from published research, FDA-approved prescribing information, and peer-reviewed clinical trials. It is intended for informational purposes only and does not constitute medical advice, diagnosis, or treatment recommendations. Tirzepatide is a prescription medication with a black box warning for thyroid C-cell tumors. Always consult a qualified healthcare provider before making decisions about any medication.