peptide garden
Menu
Peptide Profile

Tirzepatide

Tirzepatide (LY3298176)

An FDA-approved dual GIP/GLP-1 receptor agonist for type 2 diabetes, weight management, and sleep apnea. Head-to-head superiority over semaglutide for weight loss.

Reviewed March 2026·20 min read·17 citations·FDA-approvedPrescription required

Regulatory update: February 2026

The FDA-declared tirzepatide shortage resolution affects the legality of compounded versions. Compounding pharmacies that produced tirzepatide during the shortage must wind down production.

Updated March 17, 2026

On this page

At a glance

Tirzepatide is the first dual GIP/GLP-1 receptor agonist -- a "twincretin" that activates two gut hormone pathways instead of one. It is FDA-approved for type 2 diabetes (Mounjaro), chronic weight management (Zepbound), and obstructive sleep apnea (Zepbound). Head-to-head data shows it produces significantly greater weight loss than semaglutide.

Animal studiesStrongExtensive preclinical

Comprehensive preclinical pharmacology program supporting dual GIP/GLP-1 agonism. Demonstrated synergistic metabolic effects in multiple animal models prior to human trials.

Human evidenceExceptionally strong10,000+ participants

Multiple completed Phase III RCTs across two major programs (SURPASS for T2D, SURMOUNT for obesity) with 10,000+ total participants. Three FDA-approved indications. Head-to-head superiority over semaglutide demonstrated.

Safety dataExcellent10,000+ participants

Extensive controlled safety data from Phase III programs plus post-marketing pharmacovigilance (FAERS). Known risk profile: GI events, thyroid C-cell tumor risk (black box warning), pancreatitis, dysesthesia signal at higher doses.

How are these scores calculated?

Tirzepatide has one of the strongest clinical evidence bases of any peptide therapeutic. What that means: the efficacy for weight loss, blood sugar control, and related conditions is well-established across thousands of patients in rigorous Phase III trials. Risks are also well-characterized.

New research, delivered clearly

When new studies publish or clinical trials report results, we'll break them down in plain language.

Quick facts

Molecular weight
4,813.45 Da
Amino acids
39 (with Aib modifications)
Half-life
~5 days (once-weekly dosing)
Developer
Eli Lilly and Company
FDA status
Approved (3 indications)
WADA status
Monitoring Program (not prohibited)

Amino acid sequence

YA\u0302EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

What is tirzepatide?

Tirzepatide is a synthetic peptide -- a 39-amino-acid chain -- that simultaneously activates two receptors for gut hormones: GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1).[9] This dual-receptor approach earned it the nickname "twincretin."

The compound was developed by Eli Lilly and Company, with core patents filed in 2016. It received its first FDA approval in May 2022 as Mounjaro for type 2 diabetes, followed by approval as Zepbound for chronic weight management in November 2023, and for obstructive sleep apnea in December 2024.[17][18]

Tirzepatide is built on the GIP amino acid backbone, but has been engineered to also activate the GLP-1 receptor. Several structural modifications make it long-acting: two non-coded amino acid residues (Aib at positions 2 and 13) protect it from enzymatic breakdown, and a C20 fatty diacid moiety attached to Lys20 enables it to bind to albumin in the bloodstream, extending its half-life to approximately 5 days and allowing once-weekly dosing.

Unlike many peptides covered on Peptide Garden, tirzepatide has gone through the full FDA approval process -- large-scale Phase III trials with thousands of participants, extensive safety monitoring, and post-marketing surveillance. The evidence base here is fundamentally different from that of research-stage peptides.

How it works

In plain terms, tirzepatide mimics two gut hormones that your body naturally releases after eating. These hormones -- GIP and GLP-1 -- help control blood sugar, reduce appetite, and regulate how your body stores energy. By activating both pathways at once, tirzepatide produces stronger effects on weight and blood sugar than drugs that target only one.[10]

Think of it as working on two channels simultaneously: one primarily affecting insulin response and fat metabolism (GIP), and another primarily affecting appetite and glucose regulation (GLP-1). The combination produces more than the sum of its parts.

Detailed mechanism (for advanced readers)

Tirzepatide is an imbalanced and biased dual GIP/GLP-1 receptor agonist:[9]

GIP receptor agonism (primary):

  • Full agonist at the GIP receptor with high affinity -- this is the dominant receptor interaction
  • GIP signaling in adipose tissue promotes lipid storage and improves insulin sensitivity
  • GIP receptor activation in the brain may contribute to appetite suppression
  • The GIP component likely explains the enhanced weight loss beyond what GLP-1 agonism alone achieves

GLP-1 receptor agonism (biased):

  • Functions as a biased agonist at GLP-1R, favoring cAMP generation over beta-arrestin recruitment
  • Weaker GLP-1 receptor internalization compared with native GLP-1 -- which may contribute to a different side-effect profile
  • Glucose-dependent insulin secretion from pancreatic beta cells
  • Glucagon suppression from alpha cells
  • Delayed gastric emptying
  • Central appetite regulation via hypothalamic and brainstem GLP-1 receptors

Synergistic effects:

  • Co-activation produces synergistic insulin response and glucagonostatic response beyond either pathway alone
  • Increases adiponectin levels (improves insulin sensitivity)
  • Greater reduction in hepatic fat content compared to selective GLP-1 agonists

Pharmacokinetics:

  • C20 fatty diacid modification enables albumin binding, extending half-life to ~5 days
  • Aib residues at positions 2 and 13 provide DPP-4 resistance
  • Enables once-weekly subcutaneous dosing

How it differs from semaglutide: Semaglutide activates only the GLP-1 receptor. Tirzepatide activates both GIP and GLP-1 receptors, with a bias toward GIP. This dual mechanism is thought to explain the superior weight loss and glycemic outcomes observed in head-to-head trials.[12]

What the research says

Tirzepatide has one of the strongest evidence bases in modern pharmacology, with over 10,000 participants across Phase III programs, three FDA-approved indications, and head-to-head superiority over the leading comparator. The clinical data is world-class.

Peptide Garden evidence assessment, March 2026

Research timeline

Tirzepatide has moved from first-in-human dosing to three FDA approvals in under a decade -- a remarkably fast trajectory reflecting the strength of the clinical data:

  1. 2016Milestone

    Core patent filed

    Eli Lilly files patent (US 9,474,780) for the first dual GIP/GLP-1 receptor agonist. Tirzepatide (LY3298176) enters preclinical and early clinical development.

  2. 2020Preclinical

    Mechanism of action characterized

    Willard et al. publish the key mechanistic paper in JCI Insight, establishing tirzepatide as an 'imbalanced and biased' dual agonist with dominant GIP activity.

  3. 2021Human study

    SURPASS program reports (T2D)

    SURPASS-1 and SURPASS-2 published. SURPASS-2 demonstrates superiority over semaglutide 1 mg for both HbA1c and weight in 1,879 patients with type 2 diabetes.

  4. 2022Regulatory

    FDA approves Mounjaro (T2D)

    Tirzepatide approved as Mounjaro for type 2 diabetes (May 2022). SURMOUNT-1 published: 22.5% weight loss at highest dose in obesity.

  5. 2023Regulatory

    FDA approves Zepbound (obesity)

    Tirzepatide approved as Zepbound for chronic weight management (November 2023). Becomes the most prescribed weight management medication.

  6. 2024Regulatory

    OSA approval + diabetes prevention data

    FDA approves Zepbound for obstructive sleep apnea (December 2024). Three-year SURMOUNT-1 extension shows 94% diabetes risk reduction in prediabetes.

  7. 2024Regulatory

    Compounding era ends

    FDA removes tirzepatide from drug shortage list (October 2024). Compounding enforcement begins for 503A pharmacies (February 2025) and 503B facilities (March 2025).

  8. 2025Human study

    SURMOUNT-5: superiority over semaglutide confirmed

    Head-to-head trial (n=751) published in NEJM: tirzepatide 20.2% vs. semaglutide 13.7% weight loss at 72 weeks. Court upholds FDA compounding decision.

Human clinical trials

Tirzepatide has been studied in two major Phase III programs with a combined enrollment exceeding 10,000 participants:

SURPASS program (Type 2 Diabetes): Five core trials (SURPASS-1 through SURPASS-5) enrolling over 6,000 patients demonstrated superior glycemic control and weight loss across all comparators, including semaglutide 1 mg, insulin glargine, and insulin degludec.[4][3]

SURMOUNT program (Obesity/Weight Management): Five core trials enrolling over 5,000 patients, including the landmark SURMOUNT-1 trial and the head-to-head SURMOUNT-5 comparison against semaglutide.[1][2]

2022·Phase III, double-blind, randomized, placebo-controlled·n=2539High quality

SURMOUNT-1: Tirzepatide for obesity (without T2D)

Obesity or overweight without type 2 diabetes

Weight loss of 16.0% (5 mg), 21.4% (10 mg), and 22.5% (15 mg) vs. 3.1% placebo at 72 weeks. Among participants with prediabetes, 94% risk reduction in progression to type 2 diabetes over 176 weeks.

2025·Phase IIIb, open-label, randomized, active-controlled·n=751High quality

SURMOUNT-5: Head-to-head vs. semaglutide

Obesity without type 2 diabetes

Tirzepatide achieved 20.2% weight loss vs. 13.7% for semaglutide 2.4 mg at 72 weeks. First direct head-to-head comparison demonstrating tirzepatide's superiority for weight reduction.

2021·Phase III, open-label, randomized, active-controlled·n=1879High quality

SURPASS-2: Tirzepatide vs. semaglutide in T2D

Type 2 diabetes mellitus

Superior HbA1c reduction (up to 2.46% vs. 1.86%) and weight loss (up to 11.2 kg vs. 5.7 kg) compared with semaglutide 1 mg at 40 weeks.

2023·Phase III, double-blind, randomized withdrawal·n=670High quality

SURMOUNT-4: Weight maintenance after discontinuation

Weight maintenance in obesity

After 36 weeks of tirzepatide, participants randomized to placebo regained substantial weight. Most regained 25%+ of lost weight within one year. Demonstrates that ongoing treatment is necessary.

2024·Phase III, double-blind, randomized, placebo-controlled (2 trials)·n=469High quality

SURMOUNT-OSA: Obstructive sleep apnea

Moderate-to-severe OSA with obesity

AHI reduction of 25-29 events/hour with tirzepatide vs. 5 events/hour with placebo. Tirzepatide became the first drug approved specifically for OSA.

What makes this evidence different: Unlike many peptides on Peptide Garden, tirzepatide has been studied in large, multi-center, randomized controlled trials -- the gold standard of clinical evidence. The SURMOUNT-1 trial alone (n=2,539) enrolled more participants than the entire published human literature for most peptides combined.

What the evidence shows

People come to tirzepatide primarily for weight loss and blood sugar control. Here's what the published research tells us about the most common areas of interest:

Does tirzepatide produce significant weight loss?

Yes. Multiple Phase III RCTs consistently demonstrate 15-22% body weight loss at maximum dose. SURMOUNT-1 (n=2,539) showed 22.5% loss at 15 mg over 72 weeks. SURMOUNT-5 (n=751) demonstrated superiority over semaglutide 2.4 mg (20.2% vs. 13.7%). This is the strongest weight loss data for any approved medication.

Well-supported

Does tirzepatide reduce blood sugar in type 2 diabetes?

Yes. The SURPASS program (6,000+ patients across 5 core trials) consistently demonstrates HbA1c reductions of 1.24-2.58%. SURPASS-2 showed superiority over semaglutide 1 mg. 23-62% of patients across trials achieved normoglycemia (HbA1c <5.7%).

Well-supported

Can tirzepatide prevent type 2 diabetes?

In the SURMOUNT-1 prediabetes subgroup, tirzepatide reduced progression to type 2 diabetes by 94% vs. placebo over 176 weeks. Over 95% of prediabetic participants converted to normoglycemia. This is a remarkably strong prevention signal.

Well-supported

Is tirzepatide better than semaglutide for weight loss?

Head-to-head data from SURMOUNT-5 shows tirzepatide achieved 20.2% weight loss vs. 13.7% for semaglutide at maximum tolerated doses over 72 weeks. However, semaglutide has stronger cardiovascular outcomes data (SELECT trial), which tirzepatide has not yet matched (SURPASS-CVOT ongoing).

Well-supported

Does tirzepatide improve sleep apnea?

Yes. FDA approved tirzepatide for moderate-to-severe OSA in December 2024 based on the SURMOUNT-OSA trials. AHI was reduced by 25-29 events/hour with tirzepatide vs. 5 with placebo. The first drug approved specifically for OSA.

Well-supported

What happens when you stop tirzepatide?

SURMOUNT-4 demonstrated substantial weight regain after discontinuation. Most participants who stopped after 36 weeks regained 25%+ of lost weight within one year. Cardiometabolic improvements also reversed. This is consistent across all GLP-1 class therapies -- obesity is a chronic condition requiring ongoing treatment.

Well-supported

Does tirzepatide protect against cardiovascular events?

Not yet established. The SURPASS-CVOT trial (tirzepatide vs. dulaglutide for cardiovascular outcomes) is ongoing. Indirect evidence from metabolic improvements (weight loss, BP reduction, lipid changes) is promising. However, unlike semaglutide, tirzepatide does not yet have a dedicated CV outcomes dataset.

More research needed

Safety & side effects

What clinical trials show

Tirzepatide's safety profile is well-characterized from Phase III programs with over 10,000 participants and extensive post-marketing surveillance.[13]

Gastrointestinal events (the most common side effects): These are dose-dependent and typically most pronounced during dose escalation:

  • Nausea: ~20% (vs. ~10% comparators)
  • Diarrhea: ~16% (vs. ~9% comparators)
  • Vomiting: ~9% (vs. ~5% comparators)
  • Constipation: ~7%
  • Decreased appetite (common, dose-dependent)
  • Dyspepsia/abdominal pain (common)

GI side effects occurred in 39% (5 mg), 46% (10 mg), and 49% (15 mg) of patients. Most were mild-to-moderate, transient, and occurred during dose escalation periods. The slow dose-titration schedule (4 weeks per increment) is specifically designed to minimize these effects.

Serious safety concerns

Black box warning -- thyroid C-cell tumors: Tirzepatide caused a statistically significant increase in thyroid C-cell adenomas and carcinomas in rodent studies. Human relevance is undetermined, but the drug is contraindicated in patients with a personal or family history of medullary thyroid carcinoma (MTC) or Multiple Endocrine Neoplasia syndrome type 2 (MEN 2).

  • Pancreatitis: Acute pancreatitis has been reported. Contraindicated in patients with a history of pancreatitis.
  • Cholecystitis/gallstones: Incidence up to 0.6% in trials. Risk appears related to rapid weight loss.
  • Acute kidney injury: Reported, likely related to dehydration from GI events. Use caution in patients with renal impairment.
  • Lean mass loss: Approximately 25% of total weight lost is lean mass (the remaining 75% is fat mass). This ratio is consistent across dose groups and comparable to other weight-loss interventions.[15]
  • Weight regain on discontinuation: SURMOUNT-4 demonstrated that most patients who stop tirzepatide regain a substantial portion of lost weight within one year.[6]

Emerging safety signals

Dysesthesia at higher doses

A new safety signal has emerged from Phase III data: dysesthesia (tingling, burning, or altered skin sensation) affected approximately 21% of participants at the 12 mg dose. This signal has been identified in retatrutide data as well and may be linked to glucagon receptor activity rather than GIP/GLP-1 agonism specifically. The clinical significance and long-term implications are still being evaluated.

Heart rate increase

Tirzepatide is associated with a resting heart rate increase of 5-10 beats per minute, typically peaking at week 24. This is a class effect shared with GLP-1 receptor agonists. The cardiovascular significance is being evaluated in the ongoing SURPASS-CVOT trial.

Treatment discontinuation

Approximately 10% of participants at the 15 mg dose discontinued treatment due to adverse events in clinical trials (vs. 4% for placebo). Most discontinuations were due to GI side effects during dose escalation.

Contraindications and drug interactions

Contraindications:

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN 2)
  • History of pancreatitis
  • Hypersensitivity to tirzepatide or excipients
  • Pregnancy (animal reproductive toxicity observed)

Drug interactions:

  • Insulin / sulfonylureas: Increased hypoglycemia risk; dose reduction recommended when combining.
  • Oral medications: Delayed gastric emptying may affect absorption of co-administered oral drugs (426 documented potential interactions).
  • Oral contraceptives: Potential absorption impact during initiation and dose escalation; counsel patients.

FDA-approved dosing

Tirzepatide is available as a pre-filled pen injector (KwikPen) for once-weekly subcutaneous injection. The following dosing schedule is from the FDA-approved prescribing information for both Mounjaro and Zepbound:

Period Dose Notes
Weeks 1-4 2.5 mg/week Starter dose (not therapeutic for weight loss)
Weeks 5-8 5.0 mg/week First maintenance dose
Weeks 9-12 7.5 mg/week Escalation if additional response needed
Weeks 13-16 10.0 mg/week Maintenance dose
Weeks 17-20 12.5 mg/week Escalation if needed
Weeks 21+ 15.0 mg/week Maximum maintenance dose
  • Maintenance doses: 5 mg, 10 mg, or 15 mg weekly
  • Maximum dose: 15 mg subcutaneously once weekly
  • Administration: Subcutaneous injection in abdomen, thigh, or upper arm
  • Dose increases: In 2.5 mg increments after a minimum of 4 weeks at each dose level. Slow escalation reduces GI side effects.
  • No oral formulation is currently available (unlike semaglutide)

Important: Tirzepatide is a prescription medication. The dosing above is from FDA-approved labeling. Dosing should be supervised by a healthcare provider who can adjust based on individual tolerability and clinical response.

As of March 2026:

FDA status

Tirzepatide is FDA-approved for three indications:

  • Mounjaro (May 2022): Type 2 diabetes mellitus
  • Zepbound (November 2023): Chronic weight management in adults with obesity (BMI 30+) or overweight (BMI 27+) with at least one weight-related comorbidity
  • Zepbound (December 2024): Moderate-to-severe obstructive sleep apnea in adults with obesity

It is available only with a prescription. A monthly pre-filled pen (KwikPen) option has been approved by the FDA.[17][18]

The compounding story

This is one of the most significant regulatory developments of 2024-2025 and directly affects patient access:

  • When Eli Lilly could not meet demand, tirzepatide was placed on the FDA drug shortage list, which temporarily permitted compounding pharmacies to produce it.
  • In October 2024, the FDA removed tirzepatide from the shortage list, beginning the process of ending compounding.
  • February 18, 2025: Compounding discretion ended for Section 503A pharmacies (state-licensed).
  • March 19, 2025: Compounding discretion ended for Section 503B outsourcing facilities.
  • May 2025: US District Court upheld FDA's shortage resolution decision.

Current status: As of March 2026, tirzepatide cannot be legally compounded except for documented patient-specific medical needs (e.g., documented allergy to an inactive ingredient in the approved product). This is a significant difference from semaglutide, where some compounding flexibility has remained longer. Anyone offering "compounded tirzepatide" today is likely operating outside FDA enforcement guidelines.[16]

Pricing

  • Mounjaro (list price): ~$1,080/month (any dose strength)
  • Zepbound (list price): ~$1,086/month
  • LillyDirect (Zepbound vial, self-pay): $499/month (with timely refill)
  • With Eli Lilly Savings Card: Copay as low as $25/month for commercially insured patients
  • Medicare/Medicaid: Potential broader GLP-1 coverage beginning April 2026 (~$50/month cap)

WADA / USADA status

Tirzepatide is not prohibited by WADA. It is currently on the WADA Monitoring Program (2026) alongside semaglutide, meaning its use by athletes is being tracked but does not constitute a violation. It could potentially move to the prohibited list in future updates.

How tirzepatide compares to semaglutide

Semaglutide is the natural comparator -- both are injectable GLP-1 pathway drugs used for weight management and diabetes. Here's how they stack up based on head-to-head and cross-trial data:

Tirzepatide

FDA-approved · Dual GIP/GLP-1 agonist

Weight loss (max dose)20-22%
HbA1c reduction2.0-2.6%
CV outcomes dataPending

Mechanism

GIP + GLP-1

Dosing

Weekly SC

Approved for

3 indications

Compounding

Not permitted

Semaglutide

FDA-approved · GLP-1 agonist

Weight loss (max dose)13-17%
HbA1c reduction1.5-1.9%
CV outcomes dataSELECT (proven)

Mechanism

GLP-1 only

Dosing

Weekly SC / oral

Approved for

3+ indications

Compounding

Limited access

The key tradeoffs:

  • Weight loss: Tirzepatide wins. SURMOUNT-5 head-to-head: 20.2% vs. 13.7% at 72 weeks.[2]
  • Glycemic control: Tirzepatide wins. SURPASS-2: HbA1c reduction of 2.46% vs. 1.86%.[3]
  • Cardiovascular protection: Semaglutide wins for now. The SELECT trial (n=17,604) demonstrated a 20% reduction in MACE events. Tirzepatide's SURPASS-CVOT is still ongoing.
  • Oral option: Semaglutide has an oral formulation (Rybelsus/oral Wegovy). Tirzepatide is injection-only.
  • Compounding access: Semaglutide has maintained some compounding flexibility. Tirzepatide compounding is no longer permitted.
  • Cost: Comparable at list price (~$1,000-1,100/month).

Neither drug is universally superior. The choice between them depends on clinical priorities: maximum weight loss and glycemic control favor tirzepatide; proven cardiovascular protection and oral dosing favor semaglutide.

Related content

Peptide

Semaglutide Profile

The GLP-1 agonist that tirzepatide is most often compared against. Stronger cardiovascular outcomes data, but inferior weight loss in head-to-head trials.

Guide

How to Evaluate a Peptide Clinic

How to evaluate the clinics and telehealth providers offering tirzepatide.

News

Semaglutide Compounding Under Scrutiny

Regulatory scrutiny on compounded GLP-1 agonists — relevant context for tirzepatide access.

Tool

Price Comparison Worksheet

Compare pricing across clinics offering tirzepatide and other GLP-1 agonists.

Guide

What Is 'Ozempic Face'?

The science behind facial volume loss on GLP-1 drugs. What the evidence shows about causes, prevention, and reversibility.

References

  1. [1]
    Jastreboff AM, Aronne LJ, Ahmad NN, et al.. “Tirzepatide Once Weekly for the Treatment of Obesity.” N Engl J Med. 2022. 387(3):205-216 DOI PubMedRCT

    Landmark Phase III RCT. n=2,539. Demonstrated up to 22.5% weight loss at 15 mg dose. Basis for Zepbound approval.

  2. [2]
    Frias JP, Jastreboff AM, le Roux CW, et al.. “Tirzepatide as Compared with Semaglutide for the Treatment of Obesity.” N Engl J Med. 2025. DOI PubMedRCT

    First head-to-head comparison. n=751. Tirzepatide 20.2% vs. semaglutide 13.7% weight loss at 72 weeks. Open-label design.

  3. [3]
    Frias JP, Davies MJ, Rosenstock J, et al.. “Tirzepatide versus Semaglutide Once Weekly in Patients with Type 2 Diabetes.” N Engl J Med. 2021. 385(6):503-515 DOI PubMedRCT

    Head-to-head vs. semaglutide 1 mg in T2D. n=1,879. Superior HbA1c and weight outcomes for tirzepatide.

  4. [4]
    Rosenstock J, Wysham C, Frias JP, et al.. “Efficacy and safety of a novel dual GIP and GLP-1 receptor agonist tirzepatide in patients with type 2 diabetes (SURPASS-1).” Lancet. 2021. 398(10295):143-155 DOI PubMedRCT

    First Phase III trial for tirzepatide. n=478. Monotherapy vs. placebo in treatment-naive T2D.

  5. [5]
    Jastreboff AM, Kaplan LM, Frias JP, et al.. “Tirzepatide for Obesity Treatment and Diabetes Prevention.” N Engl J Med. 2024. DOI PubMedRCT

    Three-year extension of SURMOUNT-1 in participants with prediabetes. 94% risk reduction in progression to T2D. n=1,032 prediabetes subgroup.

  6. [6]
    Aronne LJ, Sattar N, Horn DB, et al.. “Continued Treatment With Tirzepatide for Maintenance of Weight Reduction in Adults With Obesity: The SURMOUNT-4 Randomized Clinical Trial.” JAMA. 2024. 331(1):38-48 DOI PubMedRCT

    Withdrawal design. n=670. Demonstrates substantial weight regain upon discontinuation.

  7. [7]
    Garvey WT, Frias JP, Jastreboff AM, et al.. “Tirzepatide once weekly for the treatment of obesity in people with type 2 diabetes (SURMOUNT-2).” Lancet. 2023. 402(10402):613-626 DOI PubMedRCT

    Phase III in obesity with T2D. n=938. Weight loss of 12.8-14.7% vs. 3.2% placebo.

  8. [8]
    Malhotra A, Grunstein RR, Gislason T, et al.. “Tirzepatide for the Treatment of Obstructive Sleep Apnea and Obesity.” N Engl J Med. 2024. 391(14):1288-1300 DOI PubMedRCT

    Two Phase III trials. Combined n=469. AHI reduction of 25-29 events/hour. Basis for OSA indication approval.

  9. [9]
    Willard FS, Douros JD, Gabe MBN, et al.. “Tirzepatide is an imbalanced and biased dual GIP and GLP-1 receptor agonist.” JCI Insight. 2020. 5(17):e140532 DOI PubMedAnimal study

    Key mechanistic paper. Establishes tirzepatide as an imbalanced agonist favoring GIP over GLP-1 receptor activation.

  10. [10]
    Min T, Bain SC. “Tirzepatide, a dual GIP/GLP-1 receptor co-agonist for the treatment of type 2 diabetes with unmatched effectiveness regarding glycaemic control and body weight reduction.” Cardiovasc Diabetol. 2022. 21(1):192 DOI PubMedReview

    Comprehensive review of the SURPASS program with cardiovascular context.

  11. [11]
    Rosenstock J, Frias JP, Rodbard HW, et al.. “The Role of Tirzepatide, Dual GIP and GLP-1 Receptor Agonist, in the Management of Type 2 Diabetes: The SURPASS Clinical Trials.” Ther Adv Endocrinol Metab. 2021. 12 DOI PubMedReview
  12. [12]
    Gasbjerg LS, Rosenkilde MM, et al.. “Insights into the Mechanism of Action of Tirzepatide: A Narrative Review.” Diabetes Ther. 2025. 16(3) DOI PubMedReview

    Up-to-date narrative review of tirzepatide's pharmacology and dual receptor mechanism.

  13. [13]
    Chen Y, et al.. “Real-World Safety Concerns of Tirzepatide: A Retrospective Analysis of FAERS Data (2022-2025).” Drug Saf. 2025. PubMedReview

    Analysis of 638,153 adverse events in FAERS. 8,096 tirzepatide-related events identified. Key signals: GI events, dosing errors, injection site reactions.

  14. [14]
    Jastreboff AM, et al.. “Body composition changes during weight reduction with tirzepatide in the SURMOUNT-1 study of adults with obesity or overweight.” Obesity (Silver Spring). 2025. PubMedRCT

    SURMOUNT-1 body composition analysis. Of weight lost, ~75% was fat mass and ~25% lean mass, consistent across dose groups.

  15. [15]
    U.S. Food and Drug Administration. “FDA clarifies policies for compounders as national GLP-1 supply begins to stabilize.” 2024. Link
  16. [16]
    U.S. Food and Drug Administration. “FDA approves novel, dual-targeted treatment for type 2 diabetes (Mounjaro NDA 215866).” 2022. Link
  17. [17]
    U.S. Food and Drug Administration. “FDA approves new medication for chronic weight management (Zepbound NDA 217806).” 2023. Link

Medical disclaimer

Peptide Garden is an educational resource, not a medical provider. The information on this page is compiled from published research, FDA-approved prescribing information, and peer-reviewed clinical trials. It is intended for informational purposes only and does not constitute medical advice, diagnosis, or treatment recommendations. Tirzepatide is a prescription medication with a black box warning for thyroid C-cell tumors. Always consult a qualified healthcare provider before making decisions about any medication.