On this page
At a glance
Kisspeptin is not a fringe wellness peptide — it is a fundamental part of human reproductive biology. Encoded by the KISS1 gene, kisspeptin is the master regulator of the reproductive hormone axis: it tells the brain to release GnRH, which triggers LH and FSH, which drive fertility. When the kisspeptin receptor (GPR54/KISS1R) is broken, humans do not go through puberty. This is established science, published in the New England Journal of Medicine.
Kisspeptin/GPR54 signaling is fundamental reproductive biology. Knockout mice fail to undergo puberty. Hundreds of preclinical studies confirm it as master regulator of GnRH.
Multiple Phase 1/2 trials: IVF trigger (Phase 2 RCTs), hypothalamic amenorrhea, male hypogonadism, and HSDD. Consistent positive results. No Phase 3 RCTs yet.
No serious adverse events in any human study. Well-tolerated via IV, SC, and intranasal routes. Acts through physiological pathways. Limited long-term data.
How are these scores calculated?
Kisspeptin occupies an unusual position in the peptide landscape: the basic science is rock-solid (loss of kisspeptin signaling = no puberty), and multiple clinical trials show consistent benefit across fertility and sexual health indications. What it lacks is Phase 3 data and FDA approval. The evidence is real and growing — but it's not yet at the finish line.
New research, delivered clearly
When new studies publish or clinical trials report results, we'll break them down in plain language.
Quick facts
- Molecular weight
- 5,857.5 Da
- Amino acids
- 54 (full-length KP-54)
- CAS Number
- 374683-24-6
- Gene
- KISS1 (chromosome 1q32.1)
- Receptor
- KISS1R (formerly GPR54)
- FDA status
- Not approved — investigational
Amino acid sequence
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
What is kisspeptin?
Kisspeptin is an endogenous neuropeptide — a signaling molecule your brain naturally produces — that serves as the master switch for human reproduction. It is encoded by the KISS1 gene and activates a receptor called KISS1R (formerly GPR54) on GnRH neurons in the hypothalamus. When kisspeptin activates these neurons, they release gonadotropin-releasing hormone (GnRH), which triggers the entire downstream cascade of reproductive hormones: LH, FSH, estrogen, progesterone, and testosterone.[1]
The KISS1 gene has an unusual origin story. It was discovered in 1996 by Danny Welch's lab at Penn State University's Hershey Medical Center — not as a reproductive gene, but as a metastasis suppressor in melanoma cells. They named it "KiSS-1" after Hershey's Kisses, the famous chocolate made in the same town. No one knew at the time that this cancer gene would turn out to be the key regulator of human fertility.
The connection to reproduction came in 2003, when two independent research groups simultaneously published landmark findings. Seminara et al. in the New England Journal of Medicine and de Roux et al. in PNAS both reported that humans with loss-of-function mutations in GPR54 (the kisspeptin receptor) had idiopathic hypogonadotropic hypogonadism — they failed to go through puberty and were infertile.[1][2]
Multiple active forms: The KISS1 gene encodes a 145-amino-acid precursor protein that is cleaved into several active peptide fragments. Kisspeptin-54 (also called metastin) is the full-length active form with 54 amino acids. Kisspeptin-10 is the minimal active fragment (the last 10 amino acids of KP-54) that retains full receptor-binding activity. KP-13 and KP-14 are intermediate fragments. All forms share the same C-terminal RF-amide motif required for KISS1R activation.
How it works
In plain terms, kisspeptin is the "go signal" for your reproductive system. It tells the brain's GnRH neurons to fire, which sets the entire hormonal cascade in motion. Without kisspeptin, the reproductive axis stays dormant — which is exactly what happens in people with KISS1R mutations and in prepubertal children (whose kisspeptin system hasn't yet activated).[1]
Detailed mechanism (for advanced readers)
Kisspeptin binds to KISS1R (a G protein-coupled receptor, formerly GPR54) expressed on GnRH neurons in the hypothalamus — specifically in two key regions:
- Arcuate nucleus (ARC): KNDy neurons (co-expressing kisspeptin, neurokinin B, and dynorphin) generate the pulsatile GnRH release that drives tonic LH/FSH secretion. These neurons are the "pulse generator" of the reproductive axis.
- Anteroventral periventricular nucleus (AVPV): Kisspeptin neurons here mediate the preovulatory LH surge in females — the hormonal signal that triggers ovulation.
Signal transduction:
KISS1R is coupled to Gq/11 proteins. Activation triggers:
- Phospholipase C (PLC) cleavage of PIP2 into IP3 and DAG
- IP3-mediated calcium release from intracellular stores
- Depolarization of GnRH neurons and increased firing rate
- GnRH release into the hypothalamic-hypophyseal portal system
- LH and FSH secretion from anterior pituitary gonadotropes
Key pharmacological distinctions:
- vs. GnRH (itself): Kisspeptin works upstream of GnRH, stimulating endogenous GnRH release. This means the magnitude of the LH response is self-limited by each person's own GnRH reserves — a crucial safety feature for IVF applications.
- vs. hCG (standard IVF trigger): hCG directly activates ovarian LH receptors with a long half-life (~36h), causing sustained stimulation that drives OHSS. Kisspeptin triggers a physiological LH surge that is self-limiting.
- vs. GnRH agonist (trigger): Both work upstream, but kisspeptin acts even further upstream — it requires intact GnRH neurons and pituitary function. This additional step provides another layer of physiological regulation.
Half-life limitation:
Kisspeptin-54 has a plasma half-life of ~28 minutes. Kisspeptin-10 is even shorter at ~4 minutes. This limits the duration of action and necessitates IV infusion or multiple SC injections for sustained effects — driving the development of longer-acting analogs like MVT-602 (half-life: 21-22 hours).[14]
What the research says
Kisspeptin has been studied in humans across four main therapeutic areas — IVF trigger, hypothalamic amenorrhea, male reproductive health, and sexual desire. The clinical research is almost entirely from one group: Waljit Dhillo's team at Imperial College London, who pioneered the first human administration in 2005 and have led the field since.[3]
IVF oocyte maturation trigger
This is the most clinically advanced application. In IVF, after ovarian stimulation produces mature follicles, a "trigger" injection is needed to cause final oocyte (egg) maturation before retrieval. The standard trigger is hCG — but in women at high risk of ovarian hyperstimulation syndrome (OHSS), hCG can be dangerous.
Kisspeptin offers a potentially safer alternative because it works upstream — triggering the body's own LH surge through endogenous GnRH release rather than directly stimulating ovarian receptors.
First IVF trigger study (dose-finding)
Women undergoing IVF at high OHSS risk
Kisspeptin-54 SC triggered 75-85% oocyte maturation across all doses. Clinical pregnancy rate 23%. Zero OHSS cases. First proof-of-concept for kisspeptin as IVF trigger.
Phase 2 multi-dose study
Women at high risk of OHSS during IVF
Oocyte maturation in 95% of women. Zero cases of moderate, severe, or critical OHSS. Markedly safer than hCG for OHSS-risk patients.
Double-dose protocol (Phase 2 RCT)
Women at high risk of OHSS during IVF
Double dose (10h apart) improved proportion achieving oocyte yield >=60% from 45% to 71%. Strongest RCT evidence for kisspeptin in IVF.
The results are consistent and promising: across all IVF trigger studies, zero women developed moderate, severe, or critical OHSS — despite all being classified as high-risk. This is the key clinical advantage over hCG trigger.[10][11]
Why this matters for women's health: OHSS is a potentially life-threatening complication of IVF affecting 1-5% of stimulated cycles. In severe cases it causes massive fluid shifts, blood clots, kidney failure, and rarely death. A safer trigger that eliminates this risk while maintaining egg maturation would be a significant advance in reproductive medicine.
Hypothalamic amenorrhea
Hypothalamic amenorrhea (HA) is a condition where stress, excessive exercise, or low body weight suppresses the kisspeptin system, shutting down GnRH pulses and causing menstrual periods to stop. It's particularly common in female athletes and women with eating disorders.
Because kisspeptin deficiency is likely the proximate cause, replacing kisspeptin is a logical therapeutic approach.
Kisspeptin in hypothalamic amenorrhea
Women with hypothalamic amenorrhea
SC kisspeptin-54 acutely stimulated LH and FSH. However, chronic twice-daily dosing caused tachyphylaxis (desensitization) — the body stopped responding. This limitation shapes current dosing strategies.
Restoring LH pulsatility in HA
Women with hypothalamic amenorrhea
IV kisspeptin-54 infusion increased LH pulse frequency 3-fold vs vehicle in all patients. Demonstrates kisspeptin can reactivate the dormant reproductive axis.
The key challenge is tachyphylaxis — continuous kisspeptin administration causes the KISS1R receptor to desensitize, and the gonadotropin response fades. This means chronic dosing doesn't work the way you'd hope. Pulsatile or intermittent dosing strategies are being explored to work around this biological limitation.[4]
Male reproductive health
Kisspeptin potently stimulates the male HPG axis. The first human kisspeptin study (Dhillo 2005) was conducted in healthy men, showing a dose-dependent ~5-fold increase in LH and downstream testosterone rise.[3]
First human administration of kisspeptin
Healthy male volunteers
IV kisspeptin-54 infusion caused dose-dependent ~5-fold increase in LH, with subsequent rises in FSH and testosterone. First proof that kisspeptin activates the HPG axis in humans.
Kisspeptin-10 increases LH pulse frequency
Healthy men
Kisspeptin-10 infusion increased LH pulse frequency and serum testosterone (from 16.6 to 24.0 nmol/L). Demonstrates kisspeptin can modulate pulsatile gonadotropin release in men.
Kisspeptin has also been tested in men with type 2 diabetes and mild hypogonadism, where it stimulated LH and testosterone secretion — suggesting potential utility for metabolic hypogonadism. However, the same tachyphylaxis concern applies, and no long-term testosterone replacement studies exist.[6]
Sexual desire & HSDD
An unexpected research avenue has emerged: kisspeptin appears to enhance sexual brain processing and arousal in humans, independent of its reproductive hormone effects.
Kisspeptin in men with HSDD
Hypoactive sexual desire disorder in men
Kisspeptin increased penile tumescence by 56% vs placebo during erotic stimuli. Enhanced sexual brain processing on fMRI. Published in JAMA Network Open.
Kisspeptin in women with HSDD
Hypoactive sexual desire disorder in women
Kisspeptin increased self-reported 'sexy' feelings vs placebo. fMRI showed modulated sexual brain processing (deactivated left inferior frontal gyrus, activated postcentral/supramarginal gyrus).
This research is early but published in high-quality journals (JAMA Network Open). It suggests kisspeptin may have direct effects on sexual desire circuits beyond just stimulating reproductive hormones — an area where PT-141 (bremelanotide) is currently the only FDA-approved option.[16][15]
Emerging research
MVT-602 (kisspeptin receptor agonist): A synthetic kisspeptin receptor agonist with a dramatically longer duration of action — LH surge lasts 21-22 hours compared to 4.7 hours for native kisspeptin-54. Tested in healthy women, PCOS patients, and women with hypothalamic amenorrhea. The prolonged, physiological LH surge more closely resembles the natural midcycle surge than any existing trigger agent. This represents the next-generation clinical approach.[14]
Intranasal delivery: A 2025 study demonstrated that intranasal kisspeptin-54 rapidly stimulates gonadotropin release in both healthy volunteers and women with hypothalamic amenorrhea — with no adverse events. This non-invasive route could make kisspeptin therapy far more practical.
Metabolic effects: Emerging research suggests kisspeptin may play roles in glucose homeostasis and insulin regulation, though this is at a very early stage.
What the evidence shows
People approach kisspeptin from different angles — fertility treatment, hormonal health, or sexual well-being. Here's what the published research actually tells us for each:
Can kisspeptin trigger oocyte maturation in IVF?
Yes. A dose-finding study (n=53) showed 75-85% oocyte maturation. A Phase 2 study (n=60) demonstrated 95% maturation with zero OHSS cases. A Phase 2 RCT (n=62) showed double-dose protocol improves oocyte yield. The mechanism is physiological — kisspeptin triggers endogenous GnRH/LH release proportional to each patient's own reserves, which appears to prevent OHSS.
Is kisspeptin safer than hCG for IVF trigger in high-risk patients?
The data strongly suggests yes. Zero cases of moderate/severe/critical OHSS across all kisspeptin trigger studies, despite enrolling only high-risk patients. hCG directly and potently stimulates ovarian receptors with a long half-life, driving OHSS. Kisspeptin's upstream, self-limiting mechanism appears to prevent this. Phase 3 data is still needed.
Can kisspeptin restore reproductive function in hypothalamic amenorrhea?
Partially. Acute kisspeptin injection potently stimulates LH/FSH in women with HA. IV infusion increases LH pulsatility 3-fold. However, chronic continuous dosing causes tachyphylaxis (desensitization). The therapeutic window requires pulsatile or intermittent dosing — an active area of research.
Does kisspeptin stimulate testosterone in men?
Yes, in the short term. IV infusion causes ~5-fold LH increase and testosterone rise in healthy men. Increases LH pulse frequency and testosterone in continued infusion. Also works in men with type 2 diabetes and mild hypogonadism. But chronic dosing likely causes tachyphylaxis, and no long-term studies exist.
Can kisspeptin treat low sexual desire?
Early but promising. In men with HSDD: 56% increase in penile tumescence vs placebo, enhanced sexual brain processing (JAMA Network Open, 2023). In women with HSDD: increased 'sexy' feelings, modulated brain activity (JAMA Network Open, 2022). These are small, single-session studies — no multi-dose efficacy trials yet.
Is kisspeptin safe?
The safety profile is excellent across all published studies. No serious adverse events in any trial. Stable blood pressure, heart rate, liver/renal function. Well-tolerated via IV, SC, and intranasal routes. Kisspeptin works through endogenous pathways (your body's own GnRH release) rather than directly stimulating end organs. Total human exposure remains limited (~300+ subjects), with no long-term data.
Safety & side effects
What clinical trials show
Kisspeptin has a remarkably clean safety profile across all published human studies. This is likely because it works through endogenous physiological pathways — it stimulates the body's own GnRH release rather than directly activating downstream receptors.[10]
Adverse events across all clinical studies:
| Category | Finding |
|---|---|
| Serious adverse events | None reported in any study |
| Blood pressure | No significant changes |
| Heart rate | No significant changes |
| Liver function | Stable throughout |
| Renal function | Stable throughout |
| Nausea | Not reported as a significant finding |
| Injection site reactions | Mild, transient (SC route) |
This stands in notable contrast to other reproductive peptides. PT-141 (bremelanotide) causes nausea in 40% of users and blood pressure increases. GnRH agonists cause hot flashes and bone density loss with chronic use. hCG trigger carries OHSS risk. Kisspeptin's physiological mechanism appears to avoid these issues.
Key safety considerations
Tachyphylaxis: The most important pharmacological limitation — chronic continuous kisspeptin administration causes receptor desensitization and loss of effect. This isn't a "side effect" in the traditional sense, but it means kisspeptin cannot be used as a continuous daily therapy. Pulsatile or intermittent dosing is required.[4]
Short half-life: Kisspeptin-54 has a plasma half-life of ~28 minutes; kisspeptin-10 is ~4 minutes. This limits the duration of therapeutic action but also means effects wear off quickly — a safety advantage in IVF applications where a brief, self-limited LH surge is desired.
Limited long-term data: Total human exposure across all published studies is approximately 300+ subjects, mostly in single-dose or short-duration protocols. Long-term safety remains unknown.
Why the safety profile makes biological sense: Kisspeptin triggers the body's own GnRH release, which then triggers the body's own LH/FSH release. At every step, the response is calibrated by the patient's own receptor reserves and feedback loops. This contrasts with hCG (which directly and potently stimulates ovarian receptors with a 36-hour half-life) or synthetic GnRH analogs (which can cause receptor desensitization with different kinetics). Kisspeptin's upstream position in the cascade may be what gives it such a favorable safety profile.
Populations not yet studied
Not systematically studied in:
- Pregnant women (though kisspeptin levels naturally rise dramatically in pregnancy)
- Children/adolescents (despite puberty being the key biological context)
- Patients with liver or kidney disease
- Elderly populations
- Long-term administration (> 8 weeks)
- Large-scale Phase 3 populations
Cancer considerations: The KISS1 gene was originally discovered as a metastasis suppressor. Paradoxically, KISS1R activation may have both pro- and anti-metastatic effects depending on the cancer type and context. This theoretical concern has not manifested in any clinical study, but it underscores the need for long-term safety monitoring.
How people use it
Clinical/research use
All human kisspeptin use to date has been in the context of clinical trials, primarily at Imperial College London / Hammersmith Hospital. There is no FDA-approved product and no standard prescription protocol.
In IVF (most advanced application):
- Route: Subcutaneous injection
- Dose: 9.6 nmol/kg (weight-adjusted), kisspeptin-54
- Timing: 36 hours before oocyte retrieval (same timing as hCG trigger)
- Double-dose protocol: Second injection 10 hours after first (shown to improve oocyte yield)
In research studies:
- IV infusion: Used for detailed hormonal profiling (1-8 hour infusions)
- SC injection: Single or repeated doses for acute effects
- Intranasal: Emerging route — 2025 data shows rapid gonadotropin stimulation
Wellness/peptide community
Kisspeptin is available as a research-grade peptide from various suppliers. Some people in the peptide community use kisspeptin-10 or kisspeptin-54 for:
- Endogenous testosterone support — stimulating natural LH/testosterone production
- PCT (post-cycle therapy) — restarting HPG axis after exogenous hormone use
- Fertility support — stimulating reproductive hormone release
About self-administration: If you're considering kisspeptin, understand that this peptide has specific pharmacological limitations (tachyphylaxis, short half-life) that require careful dosing. Continuous daily use will cause receptor desensitization and loss of effect. The clinical literature supports pulsatile/intermittent dosing — not chronic administration. A conversation with a reproductive endocrinologist or fertility specialist is the right starting point.
Legal & regulatory status
As of March 2026:
FDA status
Kisspeptin is not FDA-approved for any indication. It is used exclusively in clinical trials under Investigational New Drug (IND) applications. No NDA has been filed. Multiple Phase 2 clinical trials have been completed (primarily in the UK), but Phase 3 trials would be required for regulatory approval.
MVT-602, a kisspeptin receptor agonist with improved pharmacokinetics, is also in clinical development and may represent the most likely path to an approved kisspeptin-based therapy.
WADA / anti-doping status
Kisspeptin is not explicitly listed on the WADA Prohibited List. As an endogenous hormone, its status is nuanced:
- It could potentially fall under Section S2 (Peptide Hormones) due to its ability to stimulate LH, FSH, and testosterone
- Athletes using kisspeptin should verify with their National Anti-Doping Organization (NADO) or via GlobalDRO
- Exogenous kisspeptin detection methods are not widely validated
International status
No marketing authorization in any country. Clinical trials have been conducted primarily in the United Kingdom (Imperial College London) with some international sites for MVT-602 development. Research-grade kisspeptin is available from peptide suppliers globally but is not a regulated pharmaceutical product.
How kisspeptin compares
To put kisspeptin's evidence base in context with an FDA-approved peptide for sexual health and a common research peptide:
Kisspeptin
Investigational · Not approved
Key studies
16+
Human trials
Phase 2
FDA status
None
First studied
2005
PT-141 (Bremelanotide)
FDA-approved · Vyleesi
Total studies
43
Human trials
Phase 3
FDA status
Approved
First studied
2000
Kisspeptin and PT-141 occupy different positions in the evidence landscape. PT-141 has gone through the full FDA development pathway with Phase 3 RCTs — but its mechanism (melanocortin receptor agonism) is less fundamental to reproduction. Kisspeptin is biologically foundational to human fertility — the basic science is stronger — but it lacks the large-scale clinical data that comes with Phase 3 trials. Both are relevant to women's sexual health, but through different pathways.
What kisspeptin has that most investigational peptides don't: the biological mechanism is not speculative. It is established reproductive endocrinology, validated by human genetics (KISS1R mutations cause reproductive failure) and confirmed in every species tested.
Related content
PT-141 (Bremelanotide)
FDA-approved peptide for HSDD — works through melanocortin receptors. Different mechanism than kisspeptin but both are being studied for sexual desire disorders.
GuideHow to Reconstitute Peptides
Essential guide for preparing lyophilized peptides. Relevant for research-grade kisspeptin preparation.
NewsFDA Peptide Categories Explained
Understanding the regulatory framework that determines kisspeptin's compounding status.
ToolReconstitution Calculator
Calculate exact syringe units for kisspeptin preparation.
References
- [2]de Roux N, Genin E, Carel JC, Matsuda F, Chaussain JL, Milgrom E. “Hypogonadotropic hypogonadism due to loss of function of the KiSS1-derived peptide receptor GPR54.” Proc Natl Acad Sci U S A. 2003. 100(19):10972-10976 DOI PubMedReview
Published simultaneously with Seminara 2003. Co-discovery that GPR54 is essential for human reproduction.
- [3]Dhillo WS, Chaudhri OB, Patterson M, et al.. “Kisspeptin-54 stimulates the hypothalamic-pituitary gonadal axis in human males.” J Clin Endocrinol Metab. 2005. 90(12):6609-6615 DOI PubMedPilot study
First human administration of kisspeptin. Dose-dependent ~5-fold LH increase. Landmark proof-of-concept.
- [4]Jayasena CN, Nijher GM, Chaudhri OB, et al.. “Subcutaneous injection of kisspeptin-54 acutely stimulates gonadotropin secretion in women with hypothalamic amenorrhea, but chronic administration causes tachyphylaxis.” J Clin Endocrinol Metab. 2009. 94(11):4315-4323 DOI PubMedPilot study
Key study showing acute efficacy in HA women but also the tachyphylaxis limitation with chronic dosing.
- [5]Jayasena CN, Nijher GM, Comninos AN, et al.. “The effects of kisspeptin-10 on reproductive hormone release show sexual dimorphism in humans.” J Clin Endocrinol Metab. 2011. 96(12):E1963-E1972 DOI PubMedPilot study
Demonstrated sexual dimorphism in kisspeptin response — men more responsive than women.
- [6]George JT, Veldhuis JD, Roseweir AK, et al.. “Kisspeptin-10 is a potent stimulator of LH and increases pulse frequency in men.” J Clin Endocrinol Metab. 2011. 96(8):E1228-E1236 DOI PubMedPilot study
Detailed pulsatile LH analysis. Kisspeptin-10 infusion increased LH pulse frequency and testosterone in healthy men.
- [7]Jayasena CN, Comninos AN, Nijher GM, et al.. “Twice-daily subcutaneous injection of kisspeptin-54 does not abolish menstrual cyclicity in healthy female volunteers.” J Clin Endocrinol Metab. 2013. 98(11):4464-4474 PubMedPilot study
Safety study: chronic kisspeptin-54 SC did not disrupt menstrual cycles in healthy women.
- [9]Jayasena CN, Abbara A, Comninos AN, et al.. “Increasing LH pulsatility in women with hypothalamic amenorrhoea using intravenous infusion of kisspeptin-54.” J Clin Endocrinol Metab. 2014. 99(6):E953-E961 DOI PubMedPilot study
Small but important. IV kisspeptin-54 increased LH pulsatility 3-fold in all HA patients.
- [10]Abbara A, Jayasena CN, Christopoulos G, et al.. “Efficacy of kisspeptin-54 to trigger oocyte maturation in women at high risk of ovarian hyperstimulation syndrome (OHSS) during in vitro fertilization (IVF) therapy.” J Clin Endocrinol Metab. 2015. 100(9):3322-3331 DOI PubMedRCT
Phase 2 in 60 high-OHSS-risk women. 95% oocyte maturation. Zero OHSS cases.
- [11]Abbara A, Clarke S, Islam R, et al.. “A second dose of kisspeptin-54 improves oocyte maturation in women at high risk of ovarian hyperstimulation syndrome: a Phase 2 randomized controlled trial.” Hum Reprod. 2017. 32(9):1915-1924 DOI PubMedRCT
Phase 2 RCT. n=62. Double-dose protocol improved oocyte yield >=60% from 45% to 71%. Strongest RCT evidence.
- [15]Mills EG, Sherwood A, Sheridan R, et al.. “Effects of kisspeptin administration in women with hypoactive sexual desire disorder: a randomized clinical trial.” JAMA Netw Open. 2022. 5(10):e2236131 DOI PubMedRCT
RCT in women with HSDD. Increased 'sexy' feelings. Modulated sexual brain processing on fMRI.
- [16]Comninos AN, Demetriou L, Wall MB, et al.. “Effects of kisspeptin on sexual brain processing and penile tumescence in men with hypoactive sexual desire disorder: a randomized clinical trial.” JAMA Netw Open. 2023. 6(2):e2254313 DOI PubMedRCT
RCT in men with HSDD. 56% increase in penile tumescence. Enhanced sexual brain processing.
Medical disclaimer
Peptide Garden is an educational resource, not a medical provider. The information on this page is compiled from published research and is intended for informational purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. Kisspeptin is not FDA-approved for any indication and is currently used only in clinical trials. Always consult a qualified healthcare provider — ideally a reproductive endocrinologist or fertility specialist — before making decisions about peptide therapy.