peptide garden
Peptide Profile

Kisspeptin

Kisspeptin-54 (Metastin)

An endogenous neuropeptide that serves as the master regulator of human reproduction. Being studied as an IVF trigger, fertility treatment, and potential therapy for sexual desire disorders. Multiple Phase 2 clinical trials with strong safety profile.

Reviewed August 15, 2026·14 min read·19 citations·Not FDA-approvedActive clinical development

At a glance

Kisspeptin is not a fringe wellness peptide — it is a fundamental part of human reproductive biology. Encoded by the KISS1 gene, kisspeptin is the master regulator of the reproductive hormone axis: it tells the brain to release GnRH, which triggers LH and FSH, which drive fertility. When the kisspeptin receptor (GPR54/KISS1R) is broken, humans do not go through puberty. This is established science, published in the New England Journal of Medicine.

Animal studiesStrongHundreds of studies

Kisspeptin/GPR54 signaling is fundamental reproductive biology. Knockout mice fail to undergo puberty. Hundreds of preclinical studies confirm it as master regulator of GnRH.

Human evidenceModerate300+ participants

Multiple Phase 1/2 trials: IVF trigger (Phase 2 RCTs), hypothalamic amenorrhea, male hypogonadism, and HSDD, plus a 2026 randomized study showing intermittent dosing sustains gonadotropin secretion over 12 days. Consistent positive results. No Phase 3 RCTs yet.

Safety dataModerate300+ subjects

No serious adverse events in any human study. Well-tolerated via IV, SC, and intranasal routes. Acts through physiological pathways. Limited long-term data.

How are these scores calculated?

Kisspeptin occupies an unusual position in the peptide landscape: the basic science is rock-solid (loss of kisspeptin signaling = no puberty), and multiple clinical trials show consistent benefit across fertility and sexual health indications. What it lacks is Phase 3 data and FDA approval. The evidence is real and growing — but it's not yet at the finish line.

New research, delivered clearly

When new studies publish or clinical trials report results, we'll break them down in plain language.

Quick facts

Molecular weight
5,857.5 Da
Amino acids
54 (full-length KP-54)
CAS Number
374683-24-6
Gene
KISS1 (chromosome 1q32.1)
Receptor
KISS1R (formerly GPR54)
FDA status
Not approved — investigational

Amino acid sequence

GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2


What is kisspeptin?

Kisspeptin is an endogenous neuropeptide — a signaling molecule your brain naturally produces — that serves as the master switch for human reproduction. It is encoded by the KISS1 gene and activates a receptor called KISS1R (formerly GPR54) on GnRH neurons in the hypothalamus. When kisspeptin activates these neurons, they release gonadotropin-releasing hormone (GnRH), which triggers the entire downstream cascade of reproductive hormones: LH, FSH, estrogen, progesterone, and testosterone.[1]

The KISS1 gene has an unusual origin story. It was discovered in 1996 by Danny Welch's lab at Penn State University's Hershey Medical Center — not as a reproductive gene, but as a metastasis suppressor in melanoma cells. They named it "KiSS-1" after Hershey's Kisses, the famous chocolate made in the same town. No one knew at the time that this cancer gene would turn out to be the key regulator of human fertility.

The connection to reproduction came in 2003, when two independent research groups simultaneously published landmark findings. Seminara et al. in the New England Journal of Medicine and de Roux et al. in PNAS both reported that humans with loss-of-function mutations in GPR54 (the kisspeptin receptor) had idiopathic hypogonadotropic hypogonadism — they failed to go through puberty and were infertile.[1][2]

Multiple active forms: The KISS1 gene encodes a 145-amino-acid precursor protein that is cleaved into several active peptide fragments. Kisspeptin-54 (also called metastin) is the full-length active form with 54 amino acids. Kisspeptin-10 is the minimal active fragment (the last 10 amino acids of KP-54) that retains full receptor-binding activity. KP-13 and KP-14 are intermediate fragments. All forms share the same C-terminal RF-amide motif required for KISS1R activation.


How it works

In plain terms, kisspeptin is the "go signal" for your reproductive system. It tells the brain's GnRH neurons to fire, which sets the entire hormonal cascade in motion. Without kisspeptin, the reproductive axis stays dormant — which is exactly what happens in people with KISS1R mutations and in prepubertal children (whose kisspeptin system hasn't yet activated).[1]

Detailed mechanism (for advanced readers)

Kisspeptin binds to KISS1R (a G protein-coupled receptor, formerly GPR54) expressed on GnRH neurons in the hypothalamus — specifically in two key regions:

  • Arcuate nucleus (ARC): KNDy neurons (co-expressing kisspeptin, neurokinin B, and dynorphin) generate the pulsatile GnRH release that drives tonic LH/FSH secretion. These neurons are the "pulse generator" of the reproductive axis.
  • Anteroventral periventricular nucleus (AVPV): Kisspeptin neurons here mediate the preovulatory LH surge in females — the hormonal signal that triggers ovulation.

Signal transduction:

KISS1R is coupled to Gq/11 proteins. Activation triggers:

  1. Phospholipase C (PLC) cleavage of PIP2 into IP3 and DAG
  2. IP3-mediated calcium release from intracellular stores
  3. Depolarization of GnRH neurons and increased firing rate
  4. GnRH release into the hypothalamic-hypophyseal portal system
  5. LH and FSH secretion from anterior pituitary gonadotropes

Key pharmacological distinctions:

  • vs. GnRH (itself): Kisspeptin works upstream of GnRH, stimulating endogenous GnRH release. This means the magnitude of the LH response is self-limited by each person's own GnRH reserves — a crucial safety feature for IVF applications.
  • vs. hCG (standard IVF trigger): hCG directly activates ovarian LH receptors with a long half-life (~36h), causing sustained stimulation that drives OHSS. Kisspeptin triggers a physiological LH surge that is self-limiting.
  • vs. GnRH agonist (trigger): Both work upstream, but kisspeptin acts even further upstream — it requires intact GnRH neurons and pituitary function. This additional step provides another layer of physiological regulation.

Half-life limitation:

Kisspeptin-54 has a plasma half-life of ~28 minutes. Kisspeptin-10 is even shorter at ~4 minutes. This limits the duration of action and necessitates IV infusion or multiple SC injections for sustained effects — driving the development of longer-acting analogs like MVT-602 (half-life: 21-22 hours).[13]


What the research says

Kisspeptin has been studied in humans across four main therapeutic areas — IVF trigger, hypothalamic amenorrhea, male reproductive health, and sexual desire. The clinical research is almost entirely from one group: Waljit Dhillo's team at Imperial College London, who pioneered the first human administration in 2005 and have led the field since.[3]

IVF oocyte maturation trigger

This is the most clinically advanced application. In IVF, after ovarian stimulation produces mature follicles, a "trigger" injection is needed to cause final oocyte (egg) maturation before retrieval. The standard trigger is hCG — but in women at high risk of ovarian hyperstimulation syndrome (OHSS), hCG can be dangerous.

Kisspeptin offers a potentially safer alternative because it works upstream — triggering the body's own LH surge through endogenous GnRH release rather than directly stimulating ovarian receptors.

2014·Open-label, dose-finding·n=53Moderate quality

First IVF trigger study (dose-finding)

Women undergoing IVF at high OHSS risk

Kisspeptin-54 SC triggered 75-85% oocyte maturation across all doses. Clinical pregnancy rate 23%. Zero OHSS cases. First proof-of-concept for kisspeptin as IVF trigger.

2015·Phase 2, multi-dose, open-label, randomized·n=60Moderate quality

Phase 2 multi-dose study

Women at high risk of OHSS during IVF

Oocyte maturation in 95% of women. Zero cases of moderate, severe, or critical OHSS. Markedly safer than hCG for OHSS-risk patients.

2017·Phase 2 RCT, randomized, placebo-controlled second dose·n=62High quality

Double-dose protocol (Phase 2 RCT)

Women at high risk of OHSS during IVF

Double dose (10h apart) improved proportion achieving oocyte yield >=60% from 45% to 71%. Strongest RCT evidence for kisspeptin in IVF.

The results are consistent and promising: across all IVF trigger studies, zero women developed moderate, severe, or critical OHSS — despite all being classified as high-risk. This is the key clinical advantage over hCG trigger.[10][11]

Why this matters for women's health: OHSS is a potentially life-threatening complication of IVF affecting 1-5% of stimulated cycles. In severe cases it causes massive fluid shifts, blood clots, kidney failure, and rarely death. A safer trigger that eliminates this risk while maintaining egg maturation would be a significant advance in reproductive medicine.

Hypothalamic amenorrhea

Hypothalamic amenorrhea (HA) is a condition where stress, excessive exercise, or low body weight suppresses the kisspeptin system, shutting down GnRH pulses and causing menstrual periods to stop. It's particularly common in female athletes and women with eating disorders.

Because kisspeptin deficiency is likely the proximate cause, replacing kisspeptin is a logical therapeutic approach.

2009·Open-label, interventional·n=5Moderate quality

Kisspeptin in hypothalamic amenorrhea

Women with hypothalamic amenorrhea

SC kisspeptin-54 acutely stimulated LH and FSH. However, chronic twice-daily dosing caused tachyphylaxis (desensitization) — the body stopped responding. This limitation shapes current dosing strategies.

2014·Open-label, crossover·n=5Low quality

Restoring LH pulsatility in HA

Women with hypothalamic amenorrhea

IV kisspeptin-54 infusion increased LH pulse frequency 3-fold vs vehicle in all patients. Demonstrates kisspeptin can reactivate the dormant reproductive axis.

The key challenge has always been tachyphylaxis — continuous kisspeptin administration causes the KISS1R receptor to desensitize, and the gonadotropin response fades. For years this has been the single strongest argument that kisspeptin could work as a one-off trigger (as in IVF) but not as an ongoing treatment.[4]

A randomized study published in August 2026 is the first to test that assumption head-on, and the answer looks like it depends on the schedule rather than on the receptor. In healthy men, five days of continuous subcutaneous kisspeptin-10 infusion kept testosterone elevated but did not maintain gonadotropins — the familiar desensitization pattern. But intermittent dosing, given as a daily 8-hour infusion over 12 days, sustained the gonadotropin response throughout (mean LH change: -0.16 on vehicle, +1.68 on day 1, +1.14 on day 12; p=0.003 vs vehicle), and the receptor still responded to a bolus at day 12.[17]

It is worth being clear about how much and how little this changes. It addresses the field's central pharmacological objection, which matters. But it involved 15 healthy men across overlapping arms plus 12 controls, it measured hormones rather than menstrual cycles, fertility, or symptoms, and it says nothing about women with hypothalamic amenorrhea specifically. It makes intermittent dosing a more credible path to test — it does not show that the path works.

Male reproductive health

Kisspeptin potently stimulates the male HPG axis. The first human kisspeptin study (Dhillo 2005) was conducted in healthy men, showing a ~2.6-fold increase in LH and downstream testosterone rise.[3]

2005·Double-blind, placebo-controlled, crossover·n=6Moderate quality

First human administration of kisspeptin

Healthy male volunteers

A single 90-min IV kisspeptin-54 infusion (4 pmol/kg/min) caused a ~2.6-fold increase in LH (10.8 vs 4.2 U/L with saline), with subsequent rises in FSH and testosterone. First proof that kisspeptin activates the HPG axis in humans.

2011·Open-label, interventional·n=8Moderate quality

Kisspeptin-10 increases LH pulse frequency

Healthy men

Kisspeptin-10 infusion increased LH pulse frequency and serum testosterone (from 16.6 to 24.0 nmol/L). Demonstrates kisspeptin can modulate pulsatile gonadotropin release in men.

2026·Randomized controlled study across acute, continuous, and intermittent dosing arms·n=15Moderate quality

Chronic subcutaneous kisspeptin-10 over 12 days

Healthy men (15 across overlapping arms, plus 12 controls)

Acute infusions raised LH, FSH, and testosterone dose-dependently. Five days of continuous infusion maintained testosterone but not gonadotropins. Daily 8-hour infusions over 12 days sustained the gonadotropin response (mean LH change: -0.16 vehicle, +1.68 day 1, +1.14 day 12; p=0.003), with the receptor still responsive at day 12. Directly addresses the tachyphylaxis objection — but this is dosing pharmacology in healthy volunteers, not an efficacy trial for any condition.

Kisspeptin has also been tested in men with type 2 diabetes and mild biochemical hypogonadism, where kisspeptin-10 stimulated LH and testosterone secretion — suggesting potential utility for metabolic hypogonadism.[18] The 2026 intermittent-dosing study extends the longest published human dosing experience to 12 days, but still in healthy men, and no long-term testosterone replacement study has been conducted in men who actually need one.[17]

Sexual desire & HSDD

An unexpected research avenue has emerged: kisspeptin appears to enhance sexual brain processing and arousal in humans, independent of its reproductive hormone effects.

2023·Randomized, double-blind, placebo-controlled·n=32Moderate quality

Kisspeptin in men with HSDD

Hypoactive sexual desire disorder in men

Kisspeptin increased penile tumescence by 56% vs placebo during erotic stimuli. Enhanced sexual brain processing on fMRI. Published in JAMA Network Open.

2022·Randomized, double-blind, placebo-controlled·n=32Moderate quality

Kisspeptin in women with HSDD

Hypoactive sexual desire disorder in women

Kisspeptin increased self-reported 'sexy' feelings vs placebo. fMRI showed modulated sexual brain processing (deactivated left inferior frontal gyrus, activated postcentral/supramarginal gyrus).

This research is early but published in high-quality journals (JAMA Network Open). It suggests kisspeptin may have direct effects on sexual desire circuits beyond just stimulating reproductive hormones — an area where PT-141 (bremelanotide) is currently the only FDA-approved option.[16][15]

Emerging research

MVT-602 (kisspeptin receptor agonist): A synthetic kisspeptin receptor agonist with a dramatically longer duration of action — LH surge lasts 21-22 hours compared to 4.7 hours for native kisspeptin-54. Tested in healthy women, PCOS patients, and women with hypothalamic amenorrhea. The prolonged, physiological LH surge more closely resembles the natural midcycle surge than any existing trigger agent. This represents the next-generation clinical approach.[13]

Intranasal delivery: A 2025 study demonstrated that intranasal kisspeptin-54 rapidly stimulates gonadotropin release in both healthy volunteers and women with hypothalamic amenorrhea — with no adverse events. This non-invasive route could make kisspeptin therapy far more practical.

Metabolic effects: Emerging research suggests kisspeptin may play roles in glucose homeostasis and insulin regulation, though this is at a very early stage.


What the evidence shows

People approach kisspeptin from different angles — fertility treatment, hormonal health, or sexual well-being. Here's what the published research actually tells us for each:

Can kisspeptin trigger oocyte maturation in IVF?

Yes. A dose-finding study (n=53) showed 75-85% oocyte maturation. A Phase 2 study (n=60) demonstrated 95% maturation with zero OHSS cases. A Phase 2 RCT (n=62) showed double-dose protocol improves oocyte yield. The mechanism is physiological — kisspeptin triggers endogenous GnRH/LH release proportional to each patient's own reserves, which appears to prevent OHSS.

Well-supported

Is kisspeptin safer than hCG for IVF trigger in high-risk patients?

The data strongly suggests yes. Zero cases of moderate/severe/critical OHSS across all kisspeptin trigger studies, despite enrolling only high-risk patients. hCG directly and potently stimulates ovarian receptors with a long half-life, driving OHSS. Kisspeptin's upstream, self-limiting mechanism appears to prevent this. Phase 3 data is still needed.

Well-supported

Can kisspeptin restore reproductive function in hypothalamic amenorrhea?

Partially. Acute kisspeptin injection potently stimulates LH/FSH in women with HA. IV infusion increases LH pulsatility 3-fold. Continuous dosing causes tachyphylaxis (desensitization), long the central objection to kisspeptin as an ongoing therapy. A 2026 randomized study in 15 healthy men found that intermittent dosing sustained gonadotropin secretion over 12 days with the receptor still responsive — evidence that the obstacle is the schedule rather than the receptor. But no trial has yet shown that any schedule restores menstrual cycles in women with hypothalamic amenorrhea.

Some supporting evidence

Does kisspeptin stimulate testosterone in men?

Yes, in the short term, and a 2026 study extends that to 12 days. IV infusion causes ~2.6-fold LH increase and testosterone rise in healthy men. It also stimulated LH and testosterone in men with type 2 diabetes and mild biochemical hypogonadism. In 2026, intermittent subcutaneous dosing sustained gonadotropin secretion over 12 days in healthy men without loss of receptor responsiveness, while continuous infusion did not. Still 15 healthy men, and no long-term testosterone replacement study has been done in men who need one.

Some supporting evidence

Can kisspeptin treat low sexual desire?

Early but promising. In men with HSDD: 56% increase in penile tumescence vs placebo, enhanced sexual brain processing (JAMA Network Open, 2023). In women with HSDD: increased 'sexy' feelings, modulated brain activity (JAMA Network Open, 2022). These are small, single-session studies — no multi-dose efficacy trials yet.

Some supporting evidence

Is kisspeptin safe?

The safety profile is excellent across all published studies. No serious adverse events in any trial. Stable blood pressure, heart rate, liver/renal function. Well-tolerated via IV, SC, and intranasal routes. Kisspeptin works through endogenous pathways (your body's own GnRH release) rather than directly stimulating end organs. Total human exposure remains limited (~300+ subjects), with no long-term data.

Some supporting evidence

Safety & side effects

What clinical trials show

Kisspeptin has a remarkably clean safety profile across all published human studies. This is likely because it works through endogenous physiological pathways — it stimulates the body's own GnRH release rather than directly activating downstream receptors.[10]

Adverse events across all clinical studies:

Category Finding
Serious adverse events None reported in any study
Blood pressure No significant changes
Heart rate No significant changes
Liver function Stable throughout
Renal function Stable throughout
Nausea Not reported as a significant finding
Injection site reactions Mild, transient (SC route)

This stands in notable contrast to other reproductive peptides. PT-141 (bremelanotide) causes nausea in 40% of users and blood pressure increases. GnRH agonists cause hot flashes and bone density loss with chronic use. hCG trigger carries OHSS risk. Kisspeptin's physiological mechanism appears to avoid these issues.

Key safety considerations

Tachyphylaxis: The most important pharmacological limitation — continuous kisspeptin administration causes receptor desensitization and loss of effect.[4] This isn't a "side effect" in the traditional sense, but it means kisspeptin cannot be used as a continuous daily therapy. Intermittent dosing appears to avoid it: in a 2026 randomized study, daily 8-hour infusions over 12 days sustained gonadotropin secretion in healthy men with the receptor still responsive at day 12.[17] That is 12 days in 15 healthy men, not a therapy — but it is the best evidence to date that the schedule, not the molecule, is the obstacle.

Short half-life: Kisspeptin-54 has a plasma half-life of ~28 minutes; kisspeptin-10 is ~4 minutes. This limits the duration of therapeutic action but also means effects wear off quickly — a safety advantage in IVF applications where a brief, self-limited LH surge is desired.

Limited long-term data: Total human exposure across all published studies is approximately 300+ subjects, mostly in single-dose or short-duration protocols. Long-term safety remains unknown.

Why the safety profile makes biological sense: Kisspeptin triggers the body's own GnRH release, which then triggers the body's own LH/FSH release. At every step, the response is calibrated by the patient's own receptor reserves and feedback loops. This contrasts with hCG (which directly and potently stimulates ovarian receptors with a 36-hour half-life) or synthetic GnRH analogs (which can cause receptor desensitization with different kinetics). Kisspeptin's upstream position in the cascade may be what gives it such a favorable safety profile.

Populations not yet studied

Not systematically studied in:

  • Pregnant women (though kisspeptin levels naturally rise dramatically in pregnancy)
  • Children/adolescents (despite puberty being the key biological context)
  • Patients with liver or kidney disease
  • Elderly populations
  • Long-term administration (> 8 weeks)
  • Large-scale Phase 3 populations

Cancer considerations: The KISS1 gene was originally discovered as a metastasis suppressor. Paradoxically, KISS1R activation may have both pro- and anti-metastatic effects depending on the cancer type and context. This theoretical concern has not manifested in any clinical study, but it underscores the need for long-term safety monitoring.


How people use it

Clinical/research use

All human kisspeptin use to date has been in the context of clinical trials, primarily at Imperial College London / Hammersmith Hospital. There is no FDA-approved product and no standard prescription protocol.

In IVF (most advanced application):

  • Route: Subcutaneous injection
  • Dose: 9.6 nmol/kg (weight-adjusted), kisspeptin-54
  • Timing: 36 hours before oocyte retrieval (same timing as hCG trigger)
  • Double-dose protocol: Second injection 10 hours after first (shown to improve oocyte yield)

In research studies:

  • IV infusion: Used for detailed hormonal profiling (1-8 hour infusions)
  • SC injection: Single or repeated doses for acute effects
  • Intranasal: Emerging route — 2025 data shows rapid gonadotropin stimulation

Wellness/peptide community

Kisspeptin is available as a research-grade peptide from various suppliers. Some people in the peptide community use kisspeptin-10 or kisspeptin-54 for:

  • Endogenous testosterone support — stimulating natural LH/testosterone production
  • PCT (post-cycle therapy) — restarting HPG axis after exogenous hormone use
  • Fertility support — stimulating reproductive hormone release

About self-administration: If you're considering kisspeptin, understand that this peptide has specific pharmacological limitations (desensitization with continuous exposure, short half-life) that require careful dosing. Continuous use causes receptor desensitization and loss of effect. The clinical literature that exists supports intermittent dosing — but that literature is a handful of small studies in research settings, and no dosing regimen has been shown to treat any condition outside a clinical trial. A conversation with a reproductive endocrinologist or fertility specialist is the right starting point.


As of August 2026:

FDA status

Kisspeptin is not FDA-approved for any indication. It is used exclusively in clinical trials under Investigational New Drug (IND) applications. No NDA has been filed. Multiple Phase 2 clinical trials have been completed (primarily in the UK), but Phase 3 trials would be required for regulatory approval.

MVT-602, a kisspeptin receptor agonist with improved pharmacokinetics, is also in clinical development and may represent the most likely path to an approved kisspeptin-based therapy.

WADA / anti-doping status

Kisspeptin is not explicitly listed on the WADA Prohibited List. As an endogenous hormone, its status is nuanced:

  • It could potentially fall under Section S2 (Peptide Hormones) due to its ability to stimulate LH, FSH, and testosterone
  • Athletes using kisspeptin should verify with their National Anti-Doping Organization (NADO) or via GlobalDRO
  • Detection methods now exist. Two validated liquid chromatography-high-resolution mass spectrometry workflows for kisspeptin and its analogues in serum and urine were published in 2026 explicitly for doping-control purposes.[19] That tells you testing laboratories consider the class worth being able to detect. It does not mean kisspeptin has been added to the Prohibited List — assay development often precedes listing, and sometimes never leads to it. We have not verified kisspeptin's status against the current Prohibited List and are not asserting one.

International status

No marketing authorization in any country. Clinical trials have been conducted primarily in the United Kingdom (Imperial College London) with some international sites for MVT-602 development. Research-grade kisspeptin is available from peptide suppliers globally but is not a regulated pharmaceutical product.


How kisspeptin compares

To put kisspeptin's evidence base in context with an FDA-approved peptide for sexual health and a common research peptide:

Kisspeptin

Investigational · Not approved

Animal evidence85%
Human evidence55%
Safety data50%

Key studies

16+

Human trials

Phase 2

FDA status

None

First studied

2005

PT-141 (Bremelanotide)

FDA-approved · Vyleesi

Animal evidence75%
Human evidence85%
Safety data80%

Total studies

43

Human trials

Phase 3

FDA status

Approved

First studied

2000

Kisspeptin and PT-141 occupy different positions in the evidence landscape. PT-141 has gone through the full FDA development pathway with Phase 3 RCTs — but its mechanism (melanocortin receptor agonism) is less fundamental to reproduction. Kisspeptin is biologically foundational to human fertility — the basic science is stronger — but it lacks the large-scale clinical data that comes with Phase 3 trials. Both are relevant to women's sexual health, but through different pathways.

What kisspeptin has that most investigational peptides don't: the biological mechanism is not speculative. It is established reproductive endocrinology, validated by human genetics (KISS1R mutations cause reproductive failure) and confirmed in every species tested.



References

  1. [1]
    Seminara SB, Messager S, Chatzidaki EE, et al.. The GPR54 gene as a regulator of puberty.” N Engl J Med. 2003. 349(17):1614-1627 DOI PubMedReview

    Landmark paper. Identified GPR54 loss-of-function mutations causing absence of puberty. Established kisspeptin as essential for human reproduction.

  2. [2]
    de Roux N, Genin E, Carel JC, Matsuda F, Chaussain JL, Milgrom E. Hypogonadotropic hypogonadism due to loss of function of the KiSS1-derived peptide receptor GPR54.” Proc Natl Acad Sci U S A. 2003. 100(19):10972-10976 DOI PubMedReview

    Published simultaneously with Seminara 2003. Co-discovery that GPR54 is essential for human reproduction.

  3. [3]
    Dhillo WS, Chaudhri OB, Patterson M, et al.. Kisspeptin-54 stimulates the hypothalamic-pituitary gonadal axis in human males.” J Clin Endocrinol Metab. 2005. 90(12):6609-6615 DOI PubMedPilot study

    First human administration of kisspeptin. ~2.6-fold LH increase. Landmark proof-of-concept.

  4. [4]
    Jayasena CN, Nijher GM, Chaudhri OB, et al.. Subcutaneous injection of kisspeptin-54 acutely stimulates gonadotropin secretion in women with hypothalamic amenorrhea, but chronic administration causes tachyphylaxis.” J Clin Endocrinol Metab. 2009. 94(11):4315-4323 DOI PubMedPilot study

    Key study showing acute efficacy in HA women but also the tachyphylaxis limitation with chronic dosing.

  5. [5]
    Jayasena CN, Nijher GM, Comninos AN, et al.. The effects of kisspeptin-10 on reproductive hormone release show sexual dimorphism in humans.” J Clin Endocrinol Metab. 2011. 96(12):E1963-E1972 DOI PubMedPilot study

    Demonstrated sexual dimorphism in kisspeptin response — men more responsive than women.

  6. [6]
    George JT, Veldhuis JD, Roseweir AK, et al.. Kisspeptin-10 is a potent stimulator of LH and increases pulse frequency in men.” J Clin Endocrinol Metab. 2011. 96(8):E1228-E1236 DOI PubMedPilot study

    Detailed pulsatile LH analysis. Kisspeptin-10 infusion increased LH pulse frequency and testosterone in healthy men.

  7. [7]
    Jayasena CN, Comninos AN, Nijher GM, et al.. Twice-daily subcutaneous injection of kisspeptin-54 does not abolish menstrual cyclicity in healthy female volunteers.” J Clin Endocrinol Metab. 2013. 98(11):4464-4474 PubMedPilot study

    Safety study: chronic kisspeptin-54 SC did not disrupt menstrual cycles in healthy women.

  8. [8]
    Jayasena CN, Abbara A, Veldhuis JD, et al.. Kisspeptin-54 triggers egg maturation in women undergoing in vitro fertilization.” J Clin Invest. 2014. 124(8):3667-3677 DOI PubMedPilot study

    First IVF trigger study. Dose-finding in 53 women. 75-85% oocyte maturation. 23% clinical pregnancy rate.

  9. [9]
    Jayasena CN, Abbara A, Comninos AN, et al.. Increasing LH pulsatility in women with hypothalamic amenorrhoea using intravenous infusion of kisspeptin-54.” J Clin Endocrinol Metab. 2014. 99(6):E953-E961 DOI PubMedPilot study

    Small but important. IV kisspeptin-54 increased LH pulsatility 3-fold in all HA patients.

  10. [10]
    Abbara A, Jayasena CN, Christopoulos G, et al.. Efficacy of kisspeptin-54 to trigger oocyte maturation in women at high risk of ovarian hyperstimulation syndrome (OHSS) during in vitro fertilization (IVF) therapy.” J Clin Endocrinol Metab. 2015. 100(9):3322-3331 DOI PubMedRCT

    Phase 2 in 60 high-OHSS-risk women. 95% oocyte maturation. Zero OHSS cases.

  11. [11]
    Abbara A, Clarke S, Islam R, et al.. A second dose of kisspeptin-54 improves oocyte maturation in women at high risk of ovarian hyperstimulation syndrome: a Phase 2 randomized controlled trial.” Hum Reprod. 2017. 32(9):1915-1924 DOI PubMedRCT

    Phase 2 RCT. n=62. Double-dose protocol improved oocyte yield >=60% from 45% to 71%. Strongest RCT evidence.

  12. [12]
    Comninos AN, Wall MB, Demetriou L, et al.. Kisspeptin modulates sexual and emotional brain processing in humans.” J Clin Invest. 2017. 127(2):709-719 DOI PubMedRCT

    Double-blind, placebo-controlled fMRI study. Kisspeptin enhanced sexual and emotional brain processing in healthy men.

  13. [13]
    Abbara A, Eng PC, Engber M, et al.. Kisspeptin receptor agonist has therapeutic potential for female reproductive disorders.” J Clin Invest. 2020. 130(12):6739-6753 DOI PubMedRCT

    Clinical trials of MVT-602. Prolonged LH surge (21-22h vs 4.7h for KP54). Next-generation therapeutic.

  14. [14]
    Abbara A, Clarke SA, Dhillo WS. Use of kisspeptin to trigger oocyte maturation during in vitro fertilisation (IVF) treatment.” Front Endocrinol. 2022. 13:972137 DOI PubMedReview

    Comprehensive review from the leading clinical group summarizing all kisspeptin IVF trigger data.

  15. [15]
    Mills EG, Sherwood A, Sheridan R, et al.. Effects of kisspeptin administration in women with hypoactive sexual desire disorder: a randomized clinical trial.” JAMA Netw Open. 2022. 5(10):e2236131 DOI PubMedRCT

    RCT in women with HSDD. Increased 'sexy' feelings. Modulated sexual brain processing on fMRI.

  16. [16]
    Comninos AN, Demetriou L, Wall MB, et al.. Effects of kisspeptin on sexual brain processing and penile tumescence in men with hypoactive sexual desire disorder: a randomized clinical trial.” JAMA Netw Open. 2023. 6(2):e2254313 DOI PubMedRCT

    RCT in men with HSDD. 56% increase in penile tumescence. Enhanced sexual brain processing.

  17. [17]
    Yeung AC, Phylactou M, Koysombat K, et al.. Chronic subcutaneous kisspeptin-10 stimulates gonadotropin secretion for 12 days in healthy men.” Eur J Endocrinol. 2026. 195(2):206-216 DOI PubMedRCT

    The first human study to show that intermittent kisspeptin-10 dosing sustains gonadotropin secretion over 12 days without receptor desensitization, directly addressing the tachyphylaxis objection. Important mechanistically, but small (15 healthy men across overlapping arms plus 12 controls), male-only, healthy-volunteer, and a pharmacology study rather than an efficacy trial for any indication. No NCT number appears in the record.

  18. [18]
    George JT, Veldhuis JD, Tena-Sempere M, Millar RP, Anderson RA. Exploring the pathophysiology of hypogonadism in men with type 2 diabetes: kisspeptin-10 stimulates serum testosterone and LH secretion in men with type 2 diabetes and mild biochemical hypogonadism.” Clin Endocrinol (Oxf). 2013. 79(1):100-104 DOI PubMedPilot study

    Small mechanistic study in men with type 2 diabetes and mild biochemical hypogonadism — the source for kisspeptin's effect in metabolic hypogonadism, which was previously attributed on this page to the healthy-volunteer George 2011 study.

  19. [19]
    Krombholz S, et al.. Analysis and characterization of kisspeptin and its analogues in serum and urine samples by liquid chromatography-high-resolution mass spectrometry for doping control purposes.” Drug Test Anal. 2026. 18(7):862-876 DOI PubMedIn vitro

    Analytical method development for detecting kisspeptin and analogues in doping control. Cited only to establish that detection methods now exist — it says nothing about whether kisspeptin is prohibited, and we have not verified its status against the current WADA Prohibited List.


Medical disclaimer

Peptide Garden is an educational resource, not a medical provider. The information on this page is compiled from published research and is intended for informational purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. Kisspeptin is not FDA-approved for any indication and is currently used only in clinical trials. Always consult a qualified healthcare provider — ideally a reproductive endocrinologist or fertility specialist — before making decisions about peptide therapy.